SecReT4
Protein ID: 60115585
T4SS name [ID]Tra_I [184]
Gene symboltraM
Locus tagSC071
StrainSalmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
Repliconplasmid pSC138 [GenBank: NC_006856] [Browse all T4SS(s) in this replicon]
Location [Strand]56254..56946 [-]
ProductTraM-like protein
Component typeTraM_I
UniProt IDQ5J410
KEGG IDsec:SC071
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 3.4e-34, Aligned region: 77..184
Protein Sequence: 230 a.a.     [Download]
>gi|60115585|ref|YP_209376.1| TraM-like protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
MTENTEPSSPSHPAPDPEILKSTIRAMKQSEQRANNVPALIKALLCTGTCLLISITGNAIQYWHSTNVER
EYFATDNGRLVRLAPTSQPAWSQNDAMAFGSQALATAFNLDFVHYRSQISSLSPRFSDEGFVGYVNALQA
SNILETIKKEKMNLTATTGAGVLVRQGQMSDGVWFWTFQYPVRMRLVGQTTSKPEQSFVFEITIQRVDPR
LKPSGMEIRQMISRNAGPNS
 
Nucleotide Sequence: 693 bp     [Download]
>gi|60115514|ref|NC_006856.1|:c56946-56254 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 plasmid pSC138, complete sequence
ATGACCGAAAATACCGAGCCATCCTCGCCATCACATCCGGCACCTGACCCGGAAATACTGAAGAGCACAA
TCAGGGCTATGAAGCAGTCAGAACAGCGGGCAAATAATGTCCCTGCGCTGATAAAAGCGCTTTTATGTAC
GGGCACATGTCTTCTTATCAGTATTACTGGTAACGCCATTCAGTACTGGCACTCAACGAATGTGGAGCGC
GAATATTTCGCTACAGACAATGGTCGTCTGGTCAGGCTGGCACCAACAAGTCAGCCAGCATGGAGTCAGA
ATGATGCAATGGCCTTTGGCAGCCAGGCACTGGCGACCGCATTCAACCTGGATTTTGTGCACTATCGTTC
ACAGATCTCCTCCCTGTCTCCGCGTTTTTCTGACGAAGGTTTTGTCGGATATGTGAATGCATTACAGGCA
TCTAACATTCTGGAGACGATCAAGAAAGAGAAGATGAATCTGACCGCCACGACAGGTGCTGGCGTTCTGG
TACGACAGGGACAAATGTCCGACGGCGTATGGTTCTGGACATTCCAGTATCCTGTCCGTATGCGTCTGGT
CGGCCAGACAACCAGCAAGCCAGAACAGTCTTTTGTTTTCGAAATCACCATCCAGCGTGTTGACCCCAGA
CTGAAACCATCCGGTATGGAAATCCGGCAGATGATCTCCCGTAACGCCGGACCGAACTCCTGA
 Primer design