SecReT4
Protein ID: 60115586
T4SS name [ID]Tra_I [184]
Gene symboltraL
Locus tagSC072
StrainSalmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
Repliconplasmid pSC138 [GenBank: NC_006856] [Browse all T4SS(s) in this replicon]
Location [Strand]56943..57290 [-]
ProductTraL-like protein
Component typeTraL_I
UniProt IDQ5J409
KEGG IDsec:SC072
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|60115586|ref|YP_209377.1| TraL-like protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
MNMHKSLVAVLGLILISSTASAATCRAGSAAQAGSNTGYERARAAADAWSQRENDVSSSLQSCLSRIKKI
SINLPQFPSLDDILSQLENQVCDAVVDKVNEKLPGNIDPWKDYNL
 
Nucleotide Sequence: 348 bp     [Download]
>gi|60115514|ref|NC_006856.1|:c57290-56943 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 plasmid pSC138, complete sequence
ATGAACATGCATAAGTCTCTGGTTGCCGTGCTCGGCCTTATCCTGATTTCATCCACGGCAAGTGCTGCAA
CCTGTCGTGCGGGTAGCGCGGCACAGGCCGGTAGTAATACAGGATATGAGCGAGCACGTGCAGCTGCGGA
TGCATGGTCACAACGTGAAAACGATGTTTCCTCATCCCTGCAGTCCTGTCTGTCACGAATCAAAAAAATC
AGCATAAACCTCCCCCAGTTCCCCAGCCTTGACGACATTCTGTCGCAGCTGGAAAACCAGGTCTGCGACG
CGGTCGTGGACAAGGTGAATGAAAAGCTGCCGGGGAATATTGATCCCTGGAAGGACTACAACCTATGA
 Primer design