SecReT4
Protein ID: 60115589
T4SS name [ID]Tra_I [184]
Gene symboltraU
Locus tagSC075
StrainSalmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
Repliconplasmid pSC138 [GenBank: NC_006856] [Browse all T4SS(s) in this replicon]
Location [Strand]58327..60237 [+]
ProductTraU-like protein
Component typeTraU_I
UniProt IDQ5J406
KEGG IDsec:SC075
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 7.2e-47, Aligned region: 124..520
Protein Sequence: 636 a.a.     [Download]
>gi|60115589|ref|YP_209380.1| TraU-like protein [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67]
MGSCAAPSAKGDDKFITTDYLQQCPRNQAILKSAIEGWGVCGTTTTFGDPRRAWVNTILAASGGSGPVPL
YPPLSHAISLFPLNRAGSVWRGKGNLMLHTEDGSAFEVGLASSQQNKHTELAPGDPGLGKSVLINTLSEI
QISSAQKNLPFIAYIDKGYSAQGLVQLIRDSLPPERKDEAVGIILSNDPEYTRNLFDVMYGAKKPITPEK
NFMSSVLCALCVDTGTGQPCNPGDTRQIINQLIELAFKEYGENNPRLYRASTEDLVDSALQDSGLYEKHD
AAWWARSTWFEVRDMLHNAGYIMAAQRAHYQAMPQLPEVSSMLGHTSLRDVFGTVQRDGSNELLLDYIRR
ALEQGHNDYPMISGYTRFMINPETRVIAVDLNNVAGDKTPAGRLKTGIMYLLAGQIAGGDFTLPQYRDEV
LKQLPREYHEIALKRINQLDQEVKTKVYDELHNARGIDFIWENLDTQEREQRKFAIRTVLSTQYLRDYPE
SVLKSANTLWLLRYKPEDIPVLRDNFNVPEFMLKRFLKMPEGPAPDGSGVPVLGVFRVKSGTLARILKFT
VGPLELWALNSSPKDSALRKTLTNKLGSVRARKILAENFPRGSATSLIEHRAGQHNSDNVIEELASELIR
KQGYNL
 
Nucleotide Sequence: 1911 bp     [Download]
>gi|60115514|ref|NC_006856.1|:58327-60237 Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67 plasmid pSC138, complete sequence
ATGGGTTCATGTGCAGCTCCATCAGCAAAAGGGGATGATAAGTTTATCACCACCGACTATTTGCAACAGT
GCCCACGAAACCAGGCCATTCTGAAATCGGCCATTGAAGGCTGGGGCGTATGTGGCACCACGACAACATT
TGGTGATCCCCGACGCGCCTGGGTGAATACCATTCTCGCGGCATCCGGAGGCTCCGGCCCGGTTCCCCTG
TATCCCCCGTTGTCACATGCCATCTCGCTTTTCCCACTTAACAGGGCAGGCTCTGTCTGGCGAGGCAAAG
GGAATCTGATGTTACATACAGAAGACGGTTCCGCATTTGAGGTTGGTCTGGCGTCATCCCAACAAAATAA
ACATACAGAACTGGCACCAGGCGATCCGGGACTGGGTAAATCAGTTCTGATTAATACGTTGTCGGAAATA
CAGATATCATCTGCTCAGAAAAACCTGCCCTTCATTGCCTATATCGATAAAGGATACAGTGCTCAGGGAC
TGGTTCAGCTTATTCGCGACAGTCTTCCTCCGGAAAGAAAAGACGAAGCTGTCGGTATTATTCTGAGCAA
TGATCCGGAATACACCCGTAACCTTTTTGACGTGATGTACGGCGCTAAAAAGCCTATTACGCCGGAAAAG
AATTTCATGTCATCGGTGCTGTGTGCTCTCTGTGTCGATACCGGTACCGGTCAACCCTGTAACCCCGGAG
ACACCCGACAAATTATCAACCAGCTTATCGAGCTGGCTTTTAAAGAGTACGGTGAAAATAATCCGCGACT
TTATCGCGCCTCAACGGAAGACCTGGTGGATTCAGCACTGCAGGACTCGGGACTGTATGAAAAACATGAT
GCAGCCTGGTGGGCCAGATCAACCTGGTTCGAAGTCCGGGATATGCTCCACAATGCCGGGTATATCATGG
CGGCTCAGCGGGCACATTATCAGGCAATGCCCCAGCTTCCCGAAGTATCCTCTATGCTGGGCCATACCAG
TCTCAGGGATGTTTTCGGTACTGTTCAGCGTGATGGTTCAAACGAGCTTCTGCTGGACTACATCCGCCGC
GCCCTGGAGCAGGGACATAACGACTACCCCATGATATCCGGGTATACCCGGTTTATGATCAACCCGGAAA
CCCGGGTTATCGCTGTCGATCTGAATAATGTTGCCGGTGACAAAACGCCTGCAGGCAGGCTTAAAACCGG
CATCATGTACCTGCTTGCAGGTCAGATCGCCGGTGGTGACTTCACCCTGCCACAATACAGGGATGAAGTG
TTAAAGCAGCTTCCACGGGAATACCATGAAATCGCTCTTAAACGTATTAACCAACTTGATCAGGAGGTTA
AGACAAAAGTTTATGATGAACTGCATAACGCCCGGGGCATTGACTTCATCTGGGAAAATCTGGATACCCA
GGAGCGTGAGCAACGCAAGTTTGCTATCCGCACGGTTCTGAGTACGCAGTATCTGAGGGACTACCCGGAA
AGCGTTCTTAAGTCAGCAAATACTCTCTGGTTACTGCGCTACAAACCCGAAGATATCCCCGTACTGAGGG
ATAACTTCAACGTTCCTGAATTTATGCTGAAACGCTTCCTGAAAATGCCGGAAGGCCCGGCACCAGATGG
TAGTGGTGTTCCTGTTCTGGGAGTATTCAGGGTAAAAAGTGGCACGCTTGCGAGAATACTCAAATTTACC
GTCGGTCCACTGGAGCTATGGGCGCTGAACTCATCGCCAAAAGACAGTGCCCTGCGTAAAACACTGACAA
ATAAGTTAGGTTCAGTTCGGGCACGTAAGATTCTGGCCGAAAACTTCCCCAGAGGTTCTGCAACGTCATT
AATTGAGCACCGGGCGGGCCAACATAACAGTGACAATGTTATTGAAGAACTGGCCTCGGAGCTCATCCGA
AAACAGGGATACAATCTCTGA
 Primer design