SecReT4
Protein ID: 62317018
T4SS name [ID]VirB [377]
Gene symbol-
Locus tagBruAb2_0059
StrainBrucella abortus bv. 1 str. 9-941
Repliconchromosome II [GenBank: NC_006933] [Browse all T4SS(s) in this replicon]
Location [Strand]56598..57686 [-]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDP0C534
KEGG IDbmb:BruAb2_0059
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.4e-66, Aligned region: 26..328
Protein Sequence: 362 a.a.     [Download]
>gi|62317018|ref|YP_222871.1| type IV secretion system protein VirB11 [Brucella abortus bv. 1 str. 9-941]
MMSNRSDFIVPDEAAVKRAASVNFHLEPLRPWLDDPQITEVCVNRPGEVFCERASAWEYYAVPNLDYEHL
ISLGTATARFVDQDISDSRPVLSAILPMGERIQIVRPPACEHGTISVTIRKPSFTRRTLEDYAQQGFFKH
VRPMSKSLTPFEQELLALKEAGDYMSFLRRAVQLERVIVVAGETGSGKTTLMKALMQEIPFDQRLITIED
VPELFLPDHPNHVHLFYPSEAKEEENAPVTAATLLRSCLRMKPTRILLAELRGGETYDFINVAASGHGGS
ITSCHAGSCELTFERLALMVLQNRQGRQLPYEIIRRLLYLVVDVVVHVHNGVHDGTGRHISEVWYDPNTK
RALSLQHSEKTQ
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|62316961|ref|NC_006933.1|:c57686-56598 Brucella abortus bv. 1 str. 9-941 chromosome II, complete sequence
ATGATGTCAAACCGAAGTGACTTTATTGTGCCTGACGAGGCGGCTGTCAAACGGGCGGCCTCGGTCAATT
TCCATCTGGAACCGCTACGCCCTTGGTTGGACGATCCGCAGATCACCGAAGTTTGCGTGAACCGGCCGGG
CGAAGTGTTCTGCGAGCGAGCAAGCGCGTGGGAATACTATGCGGTGCCAAACCTCGACTATGAACACCTG
ATTTCGCTGGGAACCGCCACCGCGCGGTTTGTGGATCAGGATATTTCGGACAGCCGACCGGTGCTGTCTG
CGATCCTGCCGATGGGTGAGCGCATTCAGATTGTGCGCCCGCCCGCATGTGAGCACGGCACCATCTCGGT
GACGATCCGCAAGCCGTCTTTCACCCGGCGCACACTGGAAGACTATGCGCAGCAGGGCTTTTTCAAACAC
GTCAGACCCATGAGTAAGAGCCTGACGCCGTTTGAACAGGAACTGCTCGCATTGAAGGAAGCTGGTGATT
ACATGAGCTTCCTGCGGCGGGCGGTACAGCTTGAAAGGGTGATCGTCGTCGCCGGCGAGACGGGATCAGG
CAAGACCACACTGATGAAAGCGCTGATGCAGGAAATTCCGTTCGATCAGCGCCTGATCACCATCGAGGAC
GTACCGGAGTTGTTCTTGCCGGACCATCCGAACCACGTCCACCTGTTTTATCCGAGCGAAGCGAAGGAAG
AAGAAAACGCACCAGTGACGGCCGCCACGCTACTGCGGAGCTGCCTGCGCATGAAACCGACGCGCATCCT
GCTTGCCGAGCTGCGCGGCGGCGAGACTTACGATTTCATCAACGTGGCCGCGTCCGGCCATGGCGGCAGC
ATCACCAGTTGCCATGCCGGTTCGTGCGAACTGACTTTCGAGCGGCTGGCATTGATGGTGTTGCAGAACC
GCCAGGGCCGCCAGTTGCCATACGAGATCATCCGCCGGCTGCTCTATCTGGTGGTGGATGTCGTCGTGCA
CGTCCACAATGGCGTGCACGACGGCACTGGCCGCCATATATCTGAAGTTTGGTACGACCCGAATACAAAA
CGGGCACTGTCACTGCAACACAGTGAGAAGACGCAATGA
 Primer design