SecReT4
Protein ID: 62317022
T4SS name [ID]VirB [377]
Gene symbol-
Locus tagBruAb2_0063
StrainBrucella abortus bv. 1 str. 9-941
Repliconchromosome II [GenBank: NC_006933] [Browse all T4SS(s) in this replicon]
Location [Strand]60418..60591 [-]
Producttype IV secretion system protein VirB7
Component typeVirB7
UniProt IDP0C535
KEGG IDbmb:BruAb2_0063
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 57 a.a.     [Download]
>gi|62317022|ref|YP_222875.1| type IV secretion system protein VirB7 [Brucella abortus bv. 1 str. 9-941]
MKKVILAFVATAFLAGCTTTGPAVVPVLDGKPRVPVNKSVPAKPPLAQPNPVDTYED
 
Nucleotide Sequence: 174 bp     [Download]
>gi|62316961|ref|NC_006933.1|:c60591-60418 Brucella abortus bv. 1 str. 9-941 chromosome II, complete sequence
ATGAAAAAGGTAATCCTTGCTTTTGTCGCCACGGCCTTCCTTGCCGGTTGCACTACAACGGGGCCGGCCG
TGGTGCCGGTTCTCGATGGCAAACCGCGGGTTCCCGTCAACAAAAGCGTTCCGGCTAAACCGCCCCTGGC
TCAGCCTAACCCCGTTGACACTTACGAGGACTAA
 Primer design