SecReT4
Protein ID: 63022002
T4SS name [ID]Tra_p [642]
Gene symboleta
Locus tagpSM19035_023
StrainStreptococcus pyogenes plasmid pSM19035 (NC_006979)
Repliconplasmid pSM19035 [GenBank: NC_006979] [Browse all T4SS(s) in this replicon]
Location [Strand]19071..19766 [-]
Producthypothetical protein
Component typeOrf13_p
UniProt IDQ54941
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 8.1e-09, Aligned region: 130..225
Protein Sequence: 231 a.a.     [Download]
>gi|63022002|ref|YP_232773.1| hypothetical protein pSM19035_023 [Streptococcus pyogenes]
MNEPTEPTLNTQELNRQELKTSNERQEIPQTEIPTETVNEPSVIKEISKKNQAKQTNSRKESLSESITKK
NVPKIHLFISILTLFIVLLIGISVIQQVQLQSVKKESELLKEQIERVKETDISQSKIDTFGRYFLTYYFS
QEKNQENYQSSLKTYVSEKVDISDWKALGKTLKSVNYYGSEQTKKGYSVEYLLNVTVEDRSKMQKITFEV
EPTKNGFLVTTQPKLTDFSFN
 
Nucleotide Sequence: 696 bp     [Download]
>gi|63021982|ref|NC_006979.1|:c19766-19071 Streptococcus pyogenes plasmid pSM19035, complete sequence
TTGAATGAACCAACAGAACCAACGCTTAATACGCAAGAATTAAACCGTCAGGAGTTAAAAACGAGTAATG
AACGCCAAGAAATACCGCAGACAGAAATTCCAACTGAAACAGTAAATGAACCTAGTGTTATTAAGGAAAT
ATCGAAAAAGAACCAAGCAAAACAAACGAATAGCAGAAAAGAATCACTATCAGAATCCATAACCAAGAAA
AATGTTCCCAAAATTCATTTGTTCATATCTATTTTGACCCTTTTTATTGTATTATTGATAGGAATAAGTG
TTATTCAACAAGTACAACTTCAATCAGTCAAAAAAGAGAGCGAATTATTGAAAGAACAAATTGAACGTGT
CAAAGAAACGGATATTTCTCAATCGAAAATAGATACTTTTGGAAGATACTTTTTGACTTACTATTTTTCA
CAGGAAAAAAATCAAGAAAATTATCAGTCAAGTTTAAAAACATATGTATCCGAAAAGGTAGATATATCCG
ATTGGAAAGCATTAGGGAAAACGCTTAAGAGTGTCAATTACTATGGTAGTGAACAAACAAAAAAAGGGTA
TAGTGTTGAATACCTTTTAAATGTTACGGTAGAGGATCGTAGTAAAATGCAAAAAATCACTTTTGAGGTT
GAACCAACTAAAAACGGCTTTCTTGTGACAACTCAACCAAAACTTACAGACTTCTCTTTTAACTGA
 Primer design