SecReT4
Protein ID: 63022004
T4SS name [ID]Tra_p [642]
Gene symbol-
Locus tagpSM19035_025
StrainStreptococcus pyogenes plasmid pSM19035 (NC_006979)
Repliconplasmid pSM19035 [GenBank: NC_006979] [Browse all T4SS(s) in this replicon]
Location [Strand]20058..20990 [-]
ProductORF psi
Component typeOrf12_p
UniProt IDQ6UZA5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 310 a.a.     [Download]
>gi|63022004|ref|YP_232775.1| ORF psi [Streptococcus pyogenes]
MDVIDQIKDTGSDILSSAGEAISNVFEGVKESVDSVLHPIDTLLGNWGSDLLEASMKIANKTTFDIPNIE
LISTITNVFVFATTTFAICIVLYKVIEAQIQASNGSGDALTANIVQKLFYSSIALATLPWAMNFFIKKIV
APIGEYVIQQVANDLNVETIGERLRNFLVSNFFNGGVSAVVLFVFVIFFAFSIAKYFVAICVFYADFLVL
TMLTPLVALSLLTDEQNYFQIWIKELLSEALTMLIKLILYLAMITLMIAEKYTLPNFMLMVGCGLLIIKT
PSALQNMWYSTKVSKGGGLGNLAMMAMFRK
 
Nucleotide Sequence: 933 bp     [Download]
>gi|63021982|ref|NC_006979.1|:c20990-20058 Streptococcus pyogenes plasmid pSM19035, complete sequence
ATGGACGTAATAGACCAAATAAAAGATACAGGATCGGATATTTTAAGTTCTGCTGGTGAGGCTATCTCTA
ATGTCTTTGAGGGCGTAAAAGAGAGTGTGGATAGTGTATTGCACCCTATTGATACCTTGTTAGGGAATTG
GGGCAGTGACCTTTTAGAAGCCAGTATGAAAATTGCCAATAAGACGACTTTTGATATTCCCAATATCGAA
TTGATTAGTACCATTACCAATGTGTTTGTCTTTGCAACGACAACCTTTGCGATTTGTATTGTGTTGTATA
AGGTCATTGAAGCGCAAATACAAGCTTCTAATGGGAGTGGTGACGCATTGACCGCTAATATTGTTCAAAA
GCTGTTTTACTCGTCTATTGCCTTAGCAACGTTGCCCTGGGCAATGAACTTTTTTATCAAAAAGATTGTT
GCACCAATCGGGGAATATGTGATTCAACAAGTCGCTAATGATTTGAACGTGGAAACGATCGGCGAACGAT
TGCGTAATTTCTTAGTATCAAATTTCTTTAATGGTGGCGTTAGTGCCGTTGTTCTCTTTGTTTTCGTGAT
CTTCTTTGCCTTTTCCATTGCCAAGTATTTTGTGGCGATTTGTGTTTTTTATGCTGATTTCTTGGTACTG
ACTATGTTAACACCATTAGTTGCCTTATCCCTTTTAACGGACGAGCAAAATTACTTTCAAATATGGATCA
AAGAATTGTTGTCCGAAGCGTTAACCATGCTAATTAAATTGATTCTCTATTTAGCAATGATTACCCTCAT
GATTGCTGAAAAATACACGTTACCAAACTTTATGTTAATGGTTGGTTGTGGCTTGTTGATTATCAAAACA
CCGTCTGCCCTACAAAATATGTGGTATTCAACTAAAGTGTCAAAAGGTGGCGGACTTGGAAACTTAGCAA
TGATGGCTATGTTTAGAAAATAA
 Primer design