SecReT4
Protein ID: 66044674
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1426
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1614863..1616401 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDQ4ZWJ5
KEGG IDpsb:Psyr_1426
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 8e-130, Aligned region: 10..496
Protein Sequence: 512 a.a.     [Download]
>gi|66044674|ref|YP_234515.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MILHTNDYLEYYLTLVGWLINGGIWNMIEDSGLFAAPFAAIVISEWLRARGEGADEGNKGVLSLARVENR
FYTAILVIILACMPLVNVSIDTIQFDRSRSEQCQYSIPNPTDTGWETSFSTLNGKSATVPVWWLFVHAMS
KAATAASVAAIPCGVDLQQVRMDVNKARINDPLLAQEVADFTNDCYARARAKLFMTQPTLSNDQLNDVNW
IGSHFFLQTSGYYSDGFSGFRSHTPRTKWPYDATRDAGLPQTTGGGGFPTCTQWWSDGSVGLRARLLEQV
SPDLLSKLAQWAKFMTQTEVSDSVIRDLVSPRKQQLTQGQVYSDYGGQVGGSVLNDFTRIAATAGQAAGS
LVMYPAMDSVRQAAPMVMAFLKMALIICIPFVLVIGMFDLKVVMTITFAAFALIFVDFWFQLARWVDSTI
LDALYGNGIGSNVPHSNFDPVFGASNAQGDLLLDFVMGAMFIALPGFWVVALGWSGMQLGSLMTGLTIGT
NGAKDAGGKGADVAMGIAKGRI
 
Nucleotide Sequence: 1539 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1616401-1614863 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGATCTTGCACACGAATGACTACCTTGAGTATTACCTGACGTTGGTCGGATGGCTCATAAACGGCGGCA
TCTGGAACATGATCGAGGACAGCGGACTCTTCGCAGCGCCCTTTGCCGCCATTGTCATCAGCGAATGGCT
CAGAGCCCGCGGTGAGGGAGCTGATGAGGGCAACAAGGGCGTCCTCTCGTTGGCCCGAGTAGAAAACCGG
TTCTACACGGCAATCCTAGTCATCATCCTGGCTTGCATGCCTCTGGTAAACGTCAGCATTGATACCATCC
AGTTCGACCGAAGCCGCTCAGAGCAATGCCAATACTCAATACCCAATCCGACTGATACAGGCTGGGAAAC
ATCCTTCAGTACGCTGAACGGTAAAAGCGCCACAGTGCCCGTCTGGTGGCTGTTTGTGCATGCGATGTCC
AAGGCAGCAACTGCGGCCTCAGTCGCAGCTATTCCCTGTGGAGTGGATTTGCAACAGGTCCGGATGGACG
TCAACAAGGCCCGCATCAACGATCCGCTGCTTGCCCAGGAGGTCGCTGACTTCACGAACGATTGCTACGC
ACGTGCGCGCGCAAAGCTGTTCATGACCCAGCCTACCCTCAGCAATGATCAACTCAACGACGTCAACTGG
ATCGGTTCACACTTCTTCCTGCAAACATCCGGCTATTACAGCGATGGTTTCTCTGGGTTCAGGTCACACA
CTCCCCGAACCAAATGGCCCTATGACGCAACCCGGGACGCGGGCCTGCCACAAACCACTGGTGGTGGTGG
GTTTCCTACATGCACTCAATGGTGGTCGGATGGAAGCGTCGGGCTCAGAGCCAGGCTGCTGGAACAGGTC
AGTCCAGATCTGCTGAGCAAGCTTGCTCAGTGGGCAAAATTCATGACCCAGACCGAAGTGAGCGACTCGG
TCATTCGCGATCTGGTCTCTCCTAGGAAGCAGCAACTGACCCAGGGTCAGGTTTATTCAGACTATGGCGG
TCAAGTCGGTGGCTCTGTGCTAAATGACTTTACACGCATTGCAGCTACAGCTGGTCAGGCGGCAGGATCT
CTTGTGATGTATCCAGCCATGGACAGTGTAAGGCAAGCAGCGCCCATGGTGATGGCCTTCCTAAAGATGG
CTCTCATCATTTGCATTCCGTTTGTACTGGTGATCGGGATGTTTGATCTGAAGGTCGTGATGACGATTAC
TTTTGCTGCGTTCGCTTTGATCTTTGTCGACTTCTGGTTCCAGTTGGCCCGCTGGGTAGATAGCACGATT
CTCGATGCCCTTTATGGTAACGGGATCGGCAGCAATGTCCCCCACTCCAATTTCGACCCAGTGTTCGGGG
CCAGCAATGCCCAAGGAGACTTACTGCTGGACTTTGTGATGGGCGCAATGTTTATAGCGCTTCCGGGATT
TTGGGTAGTGGCGCTGGGCTGGAGTGGGATGCAACTTGGTTCACTCATGACAGGGCTTACCATCGGCACC
AACGGGGCTAAAGATGCAGGAGGTAAAGGCGCTGATGTAGCAATGGGAATCGCGAAGGGGAGGATTTAA
 Primer design