SecReT4
Protein ID: 66044676
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1428
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1616775..1618142 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDQ4ZWJ3
KEGG IDpsb:Psyr_1428
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 455 a.a.     [Download]
>gi|66044676|ref|YP_234517.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MRRAAFLTIAFMSTLTAHTALAEIPGINASSSGSVIGDDVLYSVGGGNAVTMGTAGNMDSISIGGGWNSN
LVCGNMSMNNTLQNQLNGATSGFQTIMGSMISNATSAVSSLPGLIIQRANPALYNLLTNGILQGRLDFDR
SKGTCRAIADKMLDVAGGQMGWNKIAEGQAMSQAVKNGNTDAVSAVAQVEKQGGNDGITWLGGNKAGGSG
QQPIKVVGDVTRAGYNLLNGRGAADTSSISPSACNNGMVCSTWSSPQAATTFANRVLGEQQQRTCEDCTK
TTSTAGVGLTPLIQESYDSKLKALQELISGSKALTLENLTAASSDSLPVTRGVVEALRTEHDQDILAKRL
ASEVALSEVLGKALLLQRTMFTGSKEPNIAANDVALQAVSQQNSSLQQEIDNLKTELDMRRSLASNSPTA
ILQRAQSRKDSSKGIFQGDPTPDRLDQLQNPAKGN
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1618142-1616775 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGCGCCGCGCTGCCTTTCTGACTATTGCATTCATGAGCACCCTGACAGCCCATACTGCTCTCGCCGAAA
TCCCGGGAATCAATGCAAGCTCATCGGGCAGCGTGATCGGTGACGACGTGCTCTACAGCGTTGGAGGCGG
CAACGCTGTGACGATGGGTACGGCGGGGAATATGGATAGCATCAGCATCGGCGGTGGCTGGAACAGCAAC
CTGGTCTGCGGAAACATGAGTATGAATAACACGCTCCAGAATCAGTTGAATGGAGCAACTTCCGGATTTC
AGACGATCATGGGGTCGATGATCTCGAACGCTACCAGCGCCGTTTCATCACTACCAGGACTGATTATCCA
GCGGGCTAACCCGGCTTTGTACAACCTGCTCACCAACGGCATTCTGCAGGGTCGTCTTGACTTCGACCGC
TCCAAAGGCACTTGCCGTGCCATTGCTGACAAGATGCTCGATGTCGCTGGAGGACAGATGGGCTGGAACA
AGATCGCCGAGGGCCAGGCTATGAGTCAGGCGGTGAAAAACGGGAACACAGATGCTGTCTCAGCCGTTGC
ACAGGTCGAAAAGCAGGGAGGGAATGACGGTATCACCTGGCTCGGAGGAAATAAGGCCGGCGGATCTGGC
CAGCAACCTATCAAGGTCGTAGGTGACGTTACTCGTGCGGGATACAACTTGCTGAACGGACGCGGCGCTG
CCGATACATCGTCCATTAGTCCTTCGGCCTGCAACAACGGCATGGTGTGTTCCACCTGGTCCTCGCCTCA
GGCAGCTACCACGTTCGCCAACCGGGTACTGGGAGAGCAACAACAACGCACTTGTGAGGATTGCACCAAA
ACAACCTCCACTGCCGGCGTTGGCCTCACACCTCTCATCCAGGAATCCTACGACTCCAAGCTCAAGGCGC
TGCAGGAATTGATCTCGGGCAGCAAAGCGCTCACCTTGGAAAACTTGACTGCAGCGAGTAGCGATTCTCT
GCCTGTTACCCGTGGTGTGGTCGAGGCACTCAGGACTGAGCATGACCAGGATATCCTGGCAAAACGTCTT
GCTTCAGAGGTCGCGCTATCTGAGGTTCTCGGCAAAGCGCTACTGCTTCAGCGCACCATGTTCACCGGCA
GCAAAGAGCCGAACATTGCCGCCAACGATGTGGCCCTGCAGGCGGTCAGTCAGCAGAACAGCAGCCTGCA
ACAGGAAATTGACAACCTCAAGACCGAGTTGGATATGCGTCGCAGCTTGGCCAGCAACTCACCGACAGCC
ATCCTACAGAGGGCTCAGAGCCGGAAGGACAGCTCCAAAGGCATCTTTCAAGGAGATCCAACGCCCGACC
GCCTCGATCAGCTGCAGAACCCTGCGAAAGGTAACTGA
 Primer design