SecReT4
Protein ID: 66044677
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1429
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1618163..1619101 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDQ4ZWJ2
KEGG IDpsb:Psyr_1429
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 8.6e-94, Aligned region: 30..300
Protein Sequence: 312 a.a.     [Download]
>gi|66044677|ref|YP_234518.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MNLRKPRAWAALALSISTWPAAAGTVTSATLVASTLSPDCLEYKVVGICYWLLCTPFGCKVKTSTKVRHF
VPDAVVSSYSNTGENPWIEVSSLSSSTSFAQDGGDGTTNHSNEDSLAKFKNADVIGHPGGATFSKFASAS
GYACQGAATPYMPYLLSTLDTVAWRYGVPESVYPEALIPGRREVGGLTSGDMWGSVYPRSGFIHQADDYK
AASVIAQRAGDVVTRSGQVHVYQPLLAQPQPGYWPAGELIETDATTGKWQELTPTLSQSCAVFPNSQPRV
QATDGGYAWALWRPYSCCKREGQTFLGSTDFQ
 
Nucleotide Sequence: 939 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1619101-1618163 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGAACCTGCGAAAGCCTCGAGCGTGGGCAGCCTTGGCCTTGTCGATCTCAACCTGGCCGGCAGCAGCAG
GCACGGTGACATCTGCCACCCTGGTCGCCTCAACCCTGTCGCCTGACTGCCTGGAGTACAAGGTGGTCGG
AATCTGCTACTGGCTGCTCTGCACCCCGTTTGGATGCAAGGTAAAGACGTCGACAAAGGTTCGTCACTTC
GTTCCAGACGCCGTGGTCTCAAGCTACTCGAATACCGGTGAAAACCCGTGGATTGAGGTCTCTTCATTGA
GCTCATCAACTTCGTTCGCCCAGGATGGCGGTGACGGAACCACCAATCACAGCAACGAAGATAGCCTGGC
TAAATTCAAAAACGCTGACGTCATAGGCCACCCCGGAGGAGCAACATTCAGTAAGTTTGCCAGCGCCTCG
GGCTATGCCTGCCAGGGTGCTGCCACGCCCTACATGCCCTACCTGCTGAGCACTTTGGACACTGTCGCCT
GGCGTTACGGCGTTCCAGAATCAGTGTATCCAGAAGCACTGATTCCCGGCCGTCGAGAGGTGGGTGGTCT
GACGTCGGGGGACATGTGGGGAAGCGTCTACCCTCGCAGTGGTTTTATCCATCAAGCCGACGATTACAAG
GCGGCATCCGTGATCGCGCAGCGTGCAGGTGACGTGGTCACTCGCAGCGGTCAGGTTCATGTCTATCAAC
CGCTTCTGGCACAGCCGCAACCAGGGTACTGGCCGGCAGGAGAATTGATCGAGACCGACGCCACCACCGG
TAAGTGGCAAGAGCTCACGCCGACCCTCAGTCAAAGCTGCGCGGTATTTCCAAACTCCCAGCCCCGTGTG
CAGGCAACAGATGGTGGCTACGCCTGGGCGTTATGGCGCCCGTATTCCTGCTGCAAGCGGGAAGGACAAA
CCTTTCTTGGCAGTACGGACTTTCAATGA
 Primer design