SecReT4
Protein ID: 66044678
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1430
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1619098..1619571 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDQ4ZWJ1
KEGG IDpsb:Psyr_1430
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 2e-38, Aligned region: 31..142
Protein Sequence: 157 a.a.     [Download]
>gi|66044678|ref|YP_234519.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MSPSSHYRFSCKNRMTSLILIAAIQVPFANAETWIVTDRNHPVQAPERVRLILLDESERLEAKLSEGLPA
NQQQAIAIMQQRLKSSDARRLQRDLALAQQDLVDAWSMGVTKVPAVVVDRKFVVYGETNATAAENRVAQW
RAAAQHQNASGQGDDPR
 
Nucleotide Sequence: 474 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1619571-1619098 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGTCCCCCTCCAGCCACTATCGCTTCAGCTGCAAGAACCGCATGACCTCCCTGATCTTGATTGCGGCCA
TACAGGTCCCCTTCGCGAACGCGGAGACGTGGATCGTTACTGACCGGAACCACCCAGTTCAGGCACCGGA
ACGTGTCCGGCTGATCCTCCTGGACGAATCAGAAAGGCTTGAGGCCAAGCTCTCTGAAGGACTGCCGGCT
AATCAGCAACAAGCCATCGCAATCATGCAGCAACGCCTCAAGAGCAGCGATGCGCGGCGCTTGCAACGAG
ATCTGGCTTTAGCTCAACAAGATCTCGTAGACGCTTGGAGCATGGGGGTAACGAAGGTGCCTGCAGTGGT
GGTCGACCGCAAGTTTGTTGTGTATGGGGAAACTAACGCTACGGCGGCTGAAAATCGCGTTGCCCAGTGG
CGCGCCGCCGCCCAACATCAGAACGCATCTGGCCAGGGAGACGACCCGCGATGA
 Primer design