SecReT4
Protein ID: 66044689
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1442
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1630375..1633383 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDQ4ZWI0
KEGG IDpsb:Psyr_1442
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.4e-69, Aligned region: 96..371
AAA_10 [PF12846], Evalue: 2e-46, Aligned region: 566..906
FtsK_SpoIIIE [PF01580], Evalue: 4.9e-05, Aligned region: 562..596
Protein Sequence: 1002 a.a.     [Download]
>gi|66044689|ref|YP_234530.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MTLFQRLKSRASLNSATQTDIAGDPLLSEPSAVELEQPEDDLVGDLKASDQNDVDAALERYLKRLEDQGI
PAPGDWRNPKQKPATVGDVAALYDVKPSFVDLLPWIEYLPAEQAMLLEDGKSLAAFFELTPIGTEGRDPE
WLRKVRDALENALQNSFDELDTSPWVVQFYAKDETSWDDYLRNLREYIRPQAKGSPFSELYLDLFKHHLD
AIAKPGGLFEDTTVSKLPWRGQQRRVRVVVYRRVVGDAAFRGQTPAMHLDNICQRFTGGLANAGIKSKRM
DGYDIRHWLLQWFNPHPDHLGTTLKDFDRFFQLVNKRTEDAGEDLPLVTGDDFAQGLFYREPKSDSQKGL
WYFDGQPHRVIMLDRLREAPKTGHLTGETRKGGDALHALFDKLPEDTVLAITLVITPQDVLEAHLEKLAR
KSVGDNQASLLTREAVNDARKLIGREHKLYRGSIAFYLKGNDEAQLTARSMQLTNALLGAGMEPVASDDE
VAPLNSYLRWLPGNFDVNQKRAMDWYVQMMLAQHVANLCPVWGRSSGTGHPGITLFNRGGAPLTFDPFNK
LDRQMNAHMFLFGPTGAGKSATLNNLLNQLIAVYAPRLFIVEAGNSFGLLGDFAKKLGLTVNRIKLAPNS
GVSLAPFADAIRLVNTPSQVKTLDADDLESSDEDMNAKPDEDDDERDVLGEMEIVARLMITGGEEKEEAR
LTRADRSVIRQCILAAARICSDADRTVLTEDVRNALRAAGEDTSIPEGRRNRMLEMAEAMDMFCMGADGE
MFNRTGTPWPEADLTIVDLATYAREGYNAQLSIAYISLINTVNNIAERDQYKGRPLVNVTDEGHIITKNP
LLAPYIMKITKMWRKLGAWFWLATQNMDDFPPSTAPMLNMIEWWICLNMPPDEVEKISRFRELTPAQKGL
MLSARKESGKYTEGVVLSKSMEVLFRAVPPSLYLALAMTEPEEKKQRYDLMQSMGVDELGAALEVAADLD
RKRGIEPLNITFPTPRALENLA
 
Nucleotide Sequence: 3009 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1633383-1630375 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGACTCTTTTTCAACGGCTCAAAAGCCGCGCGTCCCTCAATTCAGCTACGCAGACGGATATAGCGGGCG
ACCCTCTGCTGAGCGAGCCTTCAGCGGTCGAACTTGAACAGCCTGAGGATGATCTGGTTGGGGATTTGAA
AGCTTCAGATCAAAACGATGTGGATGCTGCCCTTGAACGTTACCTGAAGCGACTGGAGGATCAGGGCATA
CCCGCGCCAGGCGATTGGAGAAACCCGAAGCAGAAGCCTGCCACAGTTGGCGACGTCGCCGCGCTGTACG
ACGTCAAGCCGAGCTTTGTCGACCTCCTTCCATGGATTGAGTACCTGCCAGCTGAGCAAGCGATGCTGCT
TGAGGATGGCAAATCCTTGGCAGCATTCTTCGAACTGACTCCGATCGGCACTGAAGGCCGTGATCCCGAA
TGGCTTCGCAAGGTGCGTGACGCCTTGGAGAACGCGCTGCAAAACAGTTTTGACGAGCTCGATACCTCAC
CTTGGGTTGTGCAGTTCTACGCGAAGGACGAAACCAGCTGGGATGACTACCTTCGGAACCTGCGTGAATA
CATCCGACCACAGGCTAAAGGCAGCCCGTTCTCGGAGCTGTACCTGGATCTTTTCAAACATCACCTCGAC
GCAATCGCCAAACCTGGTGGTCTTTTTGAAGACACCACAGTTTCAAAATTGCCTTGGCGTGGCCAGCAGC
GCCGCGTGCGGGTGGTCGTGTATCGCCGGGTAGTCGGTGATGCAGCGTTCCGTGGCCAAACCCCTGCCAT
GCATCTGGACAACATTTGTCAGCGCTTCACAGGAGGTCTGGCCAACGCCGGCATTAAAAGCAAACGGATG
GACGGTTACGACATCCGACACTGGCTCCTGCAGTGGTTCAACCCTCATCCCGATCACCTGGGAACGACGC
TCAAAGACTTTGATCGCTTCTTTCAACTGGTGAACAAACGCACAGAGGATGCCGGCGAGGATCTCCCACT
GGTCACTGGCGACGACTTCGCACAGGGACTCTTTTATCGAGAGCCAAAATCCGACAGTCAAAAAGGCTTG
TGGTACTTCGATGGCCAGCCTCACAGAGTCATCATGCTGGATCGGCTGCGCGAAGCCCCGAAGACCGGCC
ACCTGACTGGCGAAACACGTAAAGGCGGTGATGCCTTGCATGCCCTGTTCGACAAGTTGCCTGAGGACAC
TGTGTTGGCCATCACCCTGGTCATCACCCCTCAGGACGTGCTGGAGGCTCATCTTGAGAAGCTGGCACGC
AAGTCGGTGGGTGACAACCAAGCTTCACTACTGACCCGCGAAGCGGTAAACGATGCCAGGAAACTGATCG
GTCGTGAGCACAAGCTGTACCGAGGCAGCATCGCCTTTTACCTCAAGGGAAATGACGAAGCACAGCTCAC
CGCGCGCAGCATGCAGTTGACCAACGCATTGCTGGGTGCCGGTATGGAACCCGTAGCATCTGACGACGAG
GTGGCCCCACTCAACAGCTACCTCCGTTGGCTTCCCGGGAACTTCGACGTCAATCAAAAGCGAGCCATGG
ACTGGTACGTGCAGATGATGCTCGCCCAGCATGTTGCAAACCTGTGCCCTGTGTGGGGTCGCTCCAGTGG
TACCGGGCATCCTGGCATCACGCTATTCAACCGTGGTGGGGCTCCACTGACATTTGATCCATTCAACAAG
CTGGATCGTCAGATGAATGCCCACATGTTTCTGTTCGGCCCCACAGGGGCAGGTAAGTCCGCCACGTTGA
ATAACCTGCTCAACCAGCTCATTGCGGTTTACGCTCCCCGCCTGTTCATCGTCGAGGCGGGTAACAGTTT
CGGTCTACTCGGGGATTTCGCGAAAAAGCTTGGGTTGACAGTCAACAGGATCAAGCTGGCCCCGAACTCA
GGCGTTAGCCTGGCTCCGTTCGCCGACGCTATTCGCTTGGTAAACACACCGAGCCAGGTCAAGACCTTGG
ACGCTGATGACTTAGAGAGCTCTGACGAGGACATGAATGCCAAGCCCGATGAAGACGATGATGAACGGGA
TGTCCTCGGCGAGATGGAAATCGTAGCCCGTTTGATGATCACCGGCGGTGAGGAAAAAGAGGAAGCTCGG
CTGACCCGGGCTGACCGCAGCGTAATCCGACAGTGCATCCTTGCAGCGGCCAGAATTTGCTCCGACGCCG
ATCGCACCGTCCTGACGGAAGATGTCCGTAATGCGTTGCGCGCGGCCGGGGAAGACACCTCCATCCCGGA
GGGCAGACGCAATCGGATGCTTGAAATGGCCGAAGCCATGGACATGTTTTGCATGGGCGCCGACGGGGAG
ATGTTCAACCGTACCGGTACGCCTTGGCCTGAGGCAGATCTGACCATCGTCGACTTGGCCACCTACGCAC
GTGAGGGCTACAACGCCCAGTTGTCGATCGCTTACATCTCGCTGATCAACACCGTGAACAACATAGCGGA
GCGTGATCAGTACAAGGGCCGTCCTCTGGTCAACGTGACAGACGAAGGCCACATCATTACCAAAAACCCC
CTCCTCGCCCCTTACATTATGAAGATCACCAAAATGTGGCGAAAGCTCGGGGCCTGGTTCTGGCTGGCAA
CACAGAACATGGATGACTTTCCTCCCTCAACTGCACCAATGCTCAACATGATCGAGTGGTGGATCTGCTT
GAACATGCCGCCTGACGAAGTGGAGAAGATCTCCCGTTTCCGTGAGCTCACACCTGCACAGAAGGGCTTG
ATGCTGTCAGCACGCAAAGAGAGCGGTAAATACACCGAAGGCGTTGTTCTTTCGAAATCGATGGAAGTCC
TGTTTCGCGCTGTTCCGCCGAGCCTGTACCTGGCATTGGCCATGACCGAGCCTGAAGAGAAAAAACAACG
TTACGACCTGATGCAGTCCATGGGTGTCGACGAGTTGGGAGCTGCACTGGAAGTAGCCGCAGATCTCGAC
AGGAAACGAGGTATTGAACCCCTGAACATTACATTCCCAACACCCCGTGCATTGGAGAACCTGGCATGA
 Primer design