SecReT4
Protein ID: 66044690
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1443
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1633383..1633838 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDQ4ZWH9
KEGG IDpsb:Psyr_1443
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 151 a.a.     [Download]
>gi|66044690|ref|YP_234531.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MPMPTWIDHLGSARSALLYCALTAGLLAGCSTNKEQMLPHGQNTMMDVWNQGTTGSAGSASGRQLLDARS
ELRRPIDVRATQPLQDSAAYTRTAQNEIYSQFKRLPNPDLVMYVFPHLAGSDPAPVPGYTTVFPLYQRVQ
YAMPGERVEDY
 
Nucleotide Sequence: 456 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1633838-1633383 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGCCAATGCCAACCTGGATTGATCACTTGGGGTCAGCGCGCAGCGCGCTGTTGTATTGCGCTCTCACTG
CGGGCTTGCTGGCTGGATGCTCGACAAACAAAGAGCAAATGCTGCCACATGGTCAAAACACCATGATGGA
CGTCTGGAATCAAGGCACGACCGGTTCGGCCGGGAGCGCTAGTGGCCGGCAGTTGCTCGATGCGCGTTCG
GAGTTGCGCCGTCCAATCGACGTACGCGCTACCCAGCCTTTGCAGGACAGCGCGGCCTACACCCGTACCG
CTCAAAACGAGATCTACAGCCAGTTCAAACGACTGCCCAATCCGGATCTTGTCATGTATGTGTTTCCGCA
CCTTGCGGGCTCCGATCCAGCACCAGTCCCTGGCTACACCACTGTGTTCCCTCTCTATCAGCGTGTGCAG
TACGCCATGCCTGGCGAGCGGGTCGAGGACTACTGA
 Primer design