SecReT4
Protein ID: 66044691
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1444
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1633816..1635300 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDQ4ZWH8
KEGG IDpsb:Psyr_1444
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 494 a.a.     [Download]
>gi|66044691|ref|YP_234532.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MKGNPLLKYLVIPFLLLVIFVGIKSLGSAPAPSTETPAPKLTAEQAKALGVEGDTPSDTLRTVVAEGREL
KQQITDVIAQNTAVKQDNETLKQRLANIDQTVDQRLKNAQEQFKLDSQQQQQSVLEGLRKQMDELTRMGQ
NSNSNSDLPIGLGVQPGDGQQFKSETSGSDIVWIDPQDATALDSNGKPITAGNSVPASAYSFPTAFGESV
DRGQKALTTGAQSVRDDMGGQQQERKKVRRAYTLPQNSTLMGSVAMSALIGRVPVDGTVNDPYPFKVLIG
PDNLTANGIDLPDVAGAVASGTASGDWTLSCVRGQIKSLTFVFTDGTVRTLPAPVQGGNQQNNNQNNSGD
QQPIQGGLGWISDPYGIPCIAGERRSNAQQYIGSQALITAAGAGAASLIKTEGSTSSYVSNASGTLGSTG
LSGNEAMGKILTQGVTDVSSWVNKLYGQAFAAIYVLPGAQVSLHIDQELEIDYELKGRKVKYASGANHAN
ANLD
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1635300-1633816 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGAAAGGTAATCCGCTGCTCAAGTACCTGGTGATTCCATTCCTCCTGCTTGTGATTTTCGTCGGCATCA
AATCACTGGGAAGTGCCCCCGCACCAAGTACCGAAACCCCTGCTCCAAAACTGACGGCTGAGCAAGCCAA
AGCCCTTGGTGTGGAAGGCGACACGCCGAGCGACACGCTGCGCACGGTCGTCGCTGAAGGACGCGAGCTC
AAGCAGCAGATCACCGACGTCATCGCACAGAACACTGCGGTCAAACAGGATAACGAGACCCTCAAACAAC
GACTGGCAAACATTGATCAGACCGTCGACCAGCGCCTTAAAAACGCCCAGGAGCAGTTCAAGCTGGATAG
TCAGCAGCAACAGCAGAGCGTGCTGGAGGGCTTGCGCAAACAGATGGATGAACTGACCCGAATGGGACAA
AACAGTAATTCCAATTCGGACCTACCGATTGGTTTGGGTGTTCAGCCTGGTGATGGCCAACAGTTCAAAT
CGGAAACAAGCGGTTCAGACATCGTGTGGATTGATCCACAGGACGCGACGGCCCTGGACAGTAACGGTAA
ACCGATCACTGCCGGCAATAGCGTCCCAGCCAGCGCCTACAGCTTTCCTACAGCCTTCGGCGAGTCCGTA
GACCGAGGACAGAAAGCGCTCACGACAGGTGCTCAGTCTGTCCGCGATGACATGGGTGGCCAGCAACAGG
AGCGTAAGAAGGTAAGACGTGCCTACACCCTCCCTCAAAACTCGACGTTGATGGGCTCGGTGGCCATGTC
CGCATTGATCGGCCGGGTTCCTGTTGATGGGACGGTTAATGACCCCTACCCGTTCAAGGTGCTGATCGGT
CCGGACAACCTGACTGCCAATGGCATCGACCTTCCTGACGTAGCCGGTGCGGTGGCCAGCGGTACAGCGT
CCGGCGACTGGACCCTCTCATGCGTGCGGGGGCAGATCAAAAGTCTGACCTTCGTGTTTACCGACGGCAC
TGTCCGCACGTTGCCGGCACCGGTTCAGGGTGGCAATCAGCAGAACAACAACCAGAACAACTCTGGAGAC
CAACAACCCATCCAGGGTGGTCTTGGCTGGATCAGTGATCCATATGGCATTCCCTGTATTGCGGGCGAGC
GACGCAGCAATGCGCAGCAGTACATCGGTTCACAAGCCCTCATCACCGCAGCAGGCGCTGGAGCAGCATC
GTTGATCAAGACCGAGGGAAGCACCTCCTCATACGTCTCGAACGCATCTGGGACGCTGGGTAGCACCGGT
TTGTCTGGTAACGAGGCGATGGGGAAGATCCTGACCCAAGGAGTCACGGACGTTTCGAGCTGGGTTAACA
AACTCTACGGACAAGCGTTCGCGGCCATTTATGTCCTGCCTGGTGCGCAAGTCTCACTGCACATCGATCA
AGAGCTGGAAATTGACTACGAACTCAAAGGCCGCAAGGTCAAGTACGCCTCAGGAGCGAACCATGCCAAT
GCCAACCTGGATTGA
 Primer design