SecReT4
Protein ID: 66044692
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1445
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1635290..1636213 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDQ4ZWH7
KEGG IDpsb:Psyr_1445
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 3.1e-126, Aligned region: 9..305
Protein Sequence: 307 a.a.     [Download]
>gi|66044692|ref|YP_234533.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MSVLRVLTCSTLLMVLAGNAQVASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTEKLRVQS
TGGAIYLFAKEAIEPTRLQLQNAKTGEIILVDIAATEAQTDQPALEPVKIVEGETSSARYGGAATARSAK
ATTKSTDSTSRSNDEEDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKVERSLDLTTLLP
TLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQHPYLGSRGDASDTTTLYLVTR
GHGLTQAAVFSATQADPRAAQGAKHER
 
Nucleotide Sequence: 924 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1636213-1635290 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGAGTGTTTTGCGAGTACTCACATGCTCGACATTACTGATGGTGTTGGCTGGCAACGCCCAAGTCGCCT
CGGCGGTCGAGATTCTCCGGTGGGAGCGGTTGCCGCTGGCAATTCCACTGCGCATCAATCAGGAACGCAT
CGTCTTCGTTGATCAGAATGTTCGTGTTGGACTCCCGCGCTCGCTGACTGAAAAGCTGCGGGTGCAGAGC
ACGGGCGGCGCGATCTACCTGTTTGCGAAGGAAGCTATAGAGCCCACTCGACTCCAGCTGCAGAACGCCA
AGACCGGCGAGATCATTCTGGTGGACATCGCTGCTACAGAGGCACAGACCGATCAACCGGCGCTGGAGCC
GGTGAAGATTGTGGAAGGTGAAACATCATCCGCACGCTACGGAGGGGCTGCTACAGCACGCTCGGCGAAG
GCCACGACAAAGAGCACGGATTCAACCAGCCGATCGAACGATGAAGAGGATGAACCAGAGGAAGTGGTCA
AGCGAGAAACGCCCGTCCCAGTTGTCCTCACACGCTATGCAGCCCAGATGCTCTATGCACCATTGCGCAC
CGTCGAGCCTGTGGACGGCATTGCCCAGGTGAAGGTTGAGCGCAGCCTGGATCTGACCACCCTGCTTCCC
ACTCTACCTGTGAAATCCACACCCTTAGGTGCATGGCGTCTGGATGATTTTTGGGTGACCGCCGTGAAGC
TGCAGAATCAGACGGCGCAGCGCATCACGCTTGACCCTCGCGAGCTCATGGGTGAATTCGTCACTGCTGC
GTTTCAACATCCTTACCTTGGATCACGCGGCGATGCCAGTGACACCACGACCTTGTACCTGGTCACGCGG
GGACACGGGCTGACACAGGCGGCCGTATTCTCGGCGACCCAAGCAGATCCGCGTGCAGCGCAAGGAGCGA
AGCATGAAAGGTAA
 Primer design