SecReT4
Protein ID: 66044693
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1446
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1636210..1636878 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDQ4ZWH6
KEGG IDpsb:Psyr_1446
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.3e-90, Aligned region: 8..206
Protein Sequence: 222 a.a.     [Download]
>gi|66044693|ref|YP_234534.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MSRFLKLADSQRAHITSLRIAIVLLALINAGLGVGWWSAPKQMTVHVPPDLRSGSTRLWWDIPPQSVYTF
GLYIFQQMNRWPVDGEQDYQANITRLDAYITPSCKHYLQSDFELRRSSGELRKRVRGVYEIPGRGYGDSP
EIRTVTNSIDDWTVTLDITADEYYGGQLVKRALARYPLHVVRMDVDPETNPFGLAWDCYNGAPQRIEGNV
EAPATPSKGVFK
 
Nucleotide Sequence: 669 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1636878-1636210 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGAGCCGTTTTTTGAAGTTGGCGGACTCCCAACGCGCCCACATCACAAGCTTGAGAATAGCCATTGTAT
TGCTCGCGCTTATTAATGCCGGGCTCGGTGTCGGCTGGTGGAGCGCCCCCAAGCAGATGACCGTTCACGT
TCCGCCGGATCTGCGCTCGGGCAGTACACGCCTGTGGTGGGACATCCCTCCCCAGTCGGTATACACATTC
GGCCTGTACATCTTTCAGCAAATGAACCGATGGCCGGTTGATGGTGAGCAGGATTACCAGGCAAATATCA
CCCGTCTTGATGCTTACATCACGCCGTCTTGCAAGCATTACCTGCAAAGTGATTTTGAACTGCGCAGGTC
TAGCGGTGAGCTACGCAAGCGCGTCCGGGGCGTTTACGAAATCCCGGGGCGAGGCTATGGAGATTCGCCC
GAGATCAGGACGGTGACCAACTCTATCGACGACTGGACTGTCACGCTCGACATCACAGCCGACGAGTATT
ACGGCGGGCAGTTGGTCAAGCGTGCCCTCGCGAGATACCCGCTCCACGTTGTACGTATGGACGTCGACCC
TGAAACCAATCCCTTCGGCTTGGCCTGGGATTGCTACAACGGCGCACCACAGCGTATCGAGGGCAATGTT
GAAGCTCCCGCAACTCCGTCGAAAGGAGTCTTCAAATGA
 Primer design