SecReT4
Protein ID: 66044694
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1447
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1636875..1637267 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDQ4ZWH5
KEGG IDpsb:Psyr_1447
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 4.3e-41, Aligned region: 11..128
Protein Sequence: 130 a.a.     [Download]
>gi|66044694|ref|YP_234535.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MTELQQDQHEDGTLRFLPSRLNNQPVVIGGLTADEMWATVFGCSGAGFVIGLPLAFMITPSMPVVCALIG
GVLGLLIASRVLRRLKRGRPETWVYRKLQLQTAMLGPTSFNNANLVLRSGNWTCRRSEQR
 
Nucleotide Sequence: 393 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1637267-1636875 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGACTGAGCTCCAGCAAGATCAGCATGAAGACGGCACCCTGCGTTTTCTGCCCAGTCGCCTGAATAACC
AGCCCGTGGTGATTGGTGGTCTTACAGCGGATGAGATGTGGGCGACCGTTTTCGGCTGCAGCGGCGCAGG
CTTTGTGATTGGCCTGCCGCTGGCCTTCATGATCACTCCATCCATGCCCGTGGTGTGCGCCCTCATAGGA
GGAGTATTGGGACTGCTCATCGCATCTCGGGTCTTGCGACGTCTGAAACGCGGTAGACCGGAGACATGGG
TCTACCGCAAGTTGCAGCTACAGACAGCAATGCTCGGCCCGACCTCATTCAACAATGCCAACCTGGTCCT
TCGATCAGGCAACTGGACTTGCCGCCGGAGCGAGCAACGATGA
 Primer design