SecReT4
Protein ID: 66044697
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1450
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1637907..1638269 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDQ4ZWH2
KEGG IDpsb:Psyr_1450
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 6.6e-29, Aligned region: 34..112
Protein Sequence: 120 a.a.     [Download]
>gi|66044697|ref|YP_234538.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MKINLPAIRSTSSRVQICLTAVLLCTPLLSTYAQAAGTASEQANVEVMIRQLNALEAVAQRSADLPNESA
QRYHLDYPRLVSDISRIRQGLQDYLTPSRAQPRDPVEISGHYNVSGDHTP
 
Nucleotide Sequence: 363 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1638269-1637907 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
GTGAAAATCAATCTCCCCGCGATCAGATCGACGTCTTCACGCGTGCAGATCTGCTTGACCGCAGTCCTCC
TATGCACACCGTTGCTCTCCACATATGCCCAGGCAGCCGGCACGGCTTCTGAACAAGCCAATGTTGAGGT
GATGATTCGCCAGCTCAACGCGCTTGAGGCGGTTGCTCAACGCAGCGCTGATCTTCCAAACGAATCGGCT
CAGCGCTATCACCTGGATTATCCCAGGTTAGTGAGCGACATCTCCCGCATTCGCCAAGGCTTGCAGGACT
ATCTGACTCCCTCCCGGGCTCAGCCCCGCGACCCCGTCGAGATCTCAGGCCATTACAACGTCAGCGGTGA
TCACACGCCATGA
 Primer design