SecReT4
Protein ID: 66044700
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1453
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1640164..1640913 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDQ4ZWG9
KEGG IDpsb:Psyr_1453
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 3.2e-72, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|66044700|ref|YP_234541.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MADVADRAKQQQDHEQSFIGSLFTLPFRFAAVMFLSLGGAIIVEWICMYFFWPEAGWQHARAMLDHELSW
LSKGFLQSVVVQEPGRTATWLVQTTYDWLVVKTGLQDWVQHTSDYAATGQRSRGFDMRYMLGVGVSKFQD
YGLAALYTTLVFCVRLVILTLAIPLFVMTAFVGFVDGLVRRDLRRFGAGRESSYLYHKARATMVPLVIVP
WSLYLALPFSVSPLLVLLPCAALLGLAVSITASSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1640913-1640164 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGGCTGACGTTGCCGATCGCGCGAAACAGCAACAAGACCACGAACAGTCGTTCATAGGTTCTCTCTTCA
CCCTGCCCTTCCGATTCGCGGCAGTAATGTTCCTCTCTCTGGGGGGAGCCATTATCGTCGAATGGATCTG
CATGTACTTTTTCTGGCCGGAGGCCGGTTGGCAGCACGCTCGCGCAATGCTCGATCATGAACTCAGCTGG
CTCTCTAAGGGGTTCCTGCAGAGTGTGGTTGTTCAAGAGCCTGGCCGAACAGCTACATGGCTGGTTCAAA
CCACGTATGACTGGCTGGTGGTGAAGACTGGGCTTCAGGACTGGGTTCAACACACCTCTGATTATGCTGC
GACAGGACAACGATCACGCGGTTTTGATATGCGCTACATGCTCGGTGTGGGAGTCAGCAAGTTTCAGGAT
TACGGCCTTGCTGCGCTCTACACGACACTGGTGTTTTGCGTGCGCCTGGTGATCCTGACCCTCGCAATCC
CGTTATTTGTGATGACGGCATTTGTTGGTTTTGTGGACGGGCTGGTGCGCAGAGACTTGCGGCGGTTCGG
TGCCGGCCGCGAGTCCAGCTACCTCTATCACAAAGCTCGAGCAACGATGGTGCCGCTGGTGATAGTCCCC
TGGAGCCTTTACCTGGCTCTGCCATTCAGCGTGAGCCCTTTGCTAGTGCTCCTGCCATGCGCGGCACTGC
TCGGCCTGGCGGTCAGCATTACGGCGTCCAGCTTCAAAAAATACCTTTAG
 Primer design