SecReT4
Protein ID: 66044702
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1455
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1643124..1643630 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDQ4ZWG7
KEGG IDpsb:Psyr_1455
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.5e-50, Aligned region: 26..167
Protein Sequence: 168 a.a.     [Download]
>gi|66044702|ref|YP_234543.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MTRSVILGAALCLPFMICQAAELTVVEDKGGDSALPYYRSLNPEPSSSVSNDLTSQLDPVAAQGLPVRTT
RMTPGTVQGRIINAPGLQPLFLVGDDETSRRWLQERGAVLKQMQAVGLVVNVATQERLAVVRSWLPDALV
SPASGDELSQRLGLNHYPVLITPTAIEQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1643630-1643124 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGACCCGATCAGTGATCCTCGGCGCAGCGCTCTGCCTGCCATTTATGATCTGCCAAGCTGCAGAGCTCA
CCGTGGTTGAAGACAAAGGTGGTGACTCAGCGCTGCCTTACTATCGATCTCTCAATCCCGAGCCGTCCTC
TTCTGTCTCAAATGACCTGACCTCGCAACTGGATCCTGTAGCAGCACAGGGATTGCCGGTACGCACCACT
CGAATGACTCCGGGGACAGTTCAGGGCCGAATCATCAACGCGCCAGGCCTGCAGCCTTTGTTCCTGGTCG
GGGACGATGAAACTTCACGCCGATGGCTACAAGAACGCGGTGCGGTGCTGAAGCAGATGCAGGCCGTAGG
ACTGGTGGTCAACGTGGCCACACAAGAACGACTTGCCGTAGTCAGGAGTTGGTTGCCCGACGCGCTGGTG
TCCCCCGCATCAGGTGACGAGCTTTCTCAACGACTCGGCCTGAATCACTATCCGGTGTTGATCACCCCAA
CCGCCATCGAGCAATAG
 Primer design