SecReT4
Protein ID: 66044703
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1456
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1643627..1644184 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDQ4ZWG6
KEGG IDpsb:Psyr_1456
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 185 a.a.     [Download]
>gi|66044703|ref|YP_234544.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MAASVTWAGLALLCFVLTSHAAELPPPAYQLAARAANIPSEVLYSVALQESGTPLRGQLVPWPWTLNVAG
ASYRFATRADACTALIIALAQAGPKRVDVGLGQVNMGWNGQRFKSSNPCDALNPYKNLDVAAQMLAELRA
LGGDWITVAGRYHRPAGGAPAANYRKAFAKHLSRVTGIQMLVTNP
 
Nucleotide Sequence: 558 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1644184-1643627 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGGCTGCGTCAGTGACGTGGGCAGGCCTTGCCCTGCTGTGCTTCGTGTTGACAAGCCATGCAGCCGAGC
TTCCCCCGCCGGCTTATCAGTTGGCTGCCCGCGCAGCGAACATTCCGTCGGAAGTGCTCTACTCGGTGGC
ACTGCAGGAAAGTGGGACCCCACTGCGGGGCCAACTGGTCCCGTGGCCTTGGACGCTGAACGTTGCCGGT
GCTAGTTATCGTTTTGCAACCCGTGCCGATGCCTGCACCGCACTTATCATCGCACTCGCGCAGGCGGGTC
CCAAGCGGGTCGACGTCGGATTAGGTCAGGTCAACATGGGCTGGAACGGCCAGAGATTTAAATCAAGCAA
TCCGTGCGACGCGCTCAATCCCTACAAGAACCTCGATGTAGCTGCACAAATGCTCGCCGAACTGCGCGCG
CTTGGCGGTGACTGGATCACCGTAGCCGGACGCTATCACCGCCCTGCCGGCGGCGCTCCAGCAGCCAATT
ACCGCAAGGCCTTTGCCAAACATCTCAGTCGGGTAACCGGCATCCAAATGCTGGTGACCAATCCATGA
 Primer design