SecReT4
Protein ID: 66044704
T4SS name [ID]Tfc [682]
Gene symbol-
Locus tagPsyr_1457
StrainPseudomonas syringae pv. syringae B728a
Repliconchromosome [GenBank: NC_007005] [Browse all T4SS(s) in this replicon]
Location [Strand]1644169..1644915 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDQ4ZWG5
KEGG IDpsb:Psyr_1457
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 248 a.a.     [Download]
>gi|66044704|ref|YP_234545.1| unnamed protein product [Pseudomonas syringae pv. syringae B728a]
MTVYNLRMFTMTGVILITAAGMANAATNTSAQSTSREHQSALLDSQSQSSDEMLARDWNLSPQEWQRYQT
LMQSSRGVYSPGLDPLTALGIEARNDEERRRYAELQVKAEAQRTAKELAYQRAYDDAFKRLYPNLMPIAS
SAPQGATASPANQGNGRLAVFVKDDCPECSVRVKALQAQKQPFDVYMVGSQNDDERIRNWAIVSGIDPAN
VRTRQITLNHDGGRWLGLSLGGELPAVVREVNGQWLRQ
 
Nucleotide Sequence: 747 bp     [Download]
>gi|66043271|ref|NC_007005.1|:c1644915-1644169 Pseudomonas syringae pv. syringae B728a chromosome, complete genome
ATGACCGTTTACAACCTGCGAATGTTCACAATGACGGGAGTCATCCTGATCACAGCAGCTGGCATGGCCA
ACGCTGCAACCAACACCTCCGCACAGTCCACCAGTAGAGAGCACCAGAGCGCTTTGCTGGACAGCCAGTC
GCAATCGAGCGACGAGATGCTGGCACGAGACTGGAACCTGAGTCCTCAGGAATGGCAGCGCTATCAAACG
CTGATGCAGAGTTCACGAGGTGTGTATTCCCCCGGGCTGGATCCGCTGACTGCATTGGGTATCGAAGCCC
GCAATGATGAAGAGCGCCGGCGGTATGCAGAGCTCCAGGTCAAAGCCGAGGCGCAGCGCACGGCAAAAGA
ATTGGCGTATCAACGCGCATATGACGATGCCTTTAAACGCCTCTATCCCAATCTGATGCCCATCGCCAGT
TCGGCGCCCCAAGGGGCGACCGCAAGCCCTGCTAACCAGGGCAATGGCCGATTGGCAGTGTTCGTCAAGG
ACGATTGCCCGGAGTGCTCAGTTCGGGTTAAGGCCCTTCAAGCTCAGAAGCAGCCGTTTGACGTGTACAT
GGTGGGTAGCCAGAACGACGATGAGCGAATTCGCAACTGGGCGATTGTCTCGGGGATCGACCCTGCGAAT
GTCAGAACCCGACAAATCACCCTCAACCATGACGGTGGACGTTGGCTTGGCCTGAGCTTGGGTGGCGAGT
TACCGGCCGTTGTGCGAGAGGTGAATGGGCAATGGCTGCGTCAGTGA
 Primer design