SecReT4
Protein ID: 66767954
T4SS name [ID]VirB [388]
Gene symbol-
Locus tagXC_1630
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]1956087..1957760 [+]
ProductVirD4 protein
Component typeVirD4
UniProt IDQ4UW77
KEGG IDxcb:XC_1630
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1e-110, Aligned region: 108..547
TraG-D_C [PF12696], Evalue: 1.2e-28, Aligned region: 398..511
TrwB_AAD_bind [PF10412], Evalue: 5.5e-24, Aligned region: 182..517
Protein Sequence: 557 a.a.     [Download]
>gi|66767954|ref|YP_242716.1| VirD4 protein [Xanthomonas campestris pv. campestris str. 8004]
MSKLKIAAIATVVTMLIGYCLSGYLTLLLLRLDTKLYAWDTYYRYVSAMGLPEVAPYVTKIKLAGAFGFG
LPGIVWAIGMVLLVKPKQKALHGDARFAGAADLSKHGLFKPSPNGIVVGKFNGKLVRLSGQQFVILAAPT
RSGKGVGVVIPNLLEYQESVVVLDIKQENFDLTSGWRASQGHEVFLFNPFAEDRRTHRWNPLTYVSADPA
FRVSDLMSIAAMLYPDGSDDQKFWVSQARNAFMAFSLYLFENWDEELSLGFPGGAGAPTLGGIYRLSSGD
GTDLKKYLKSLSERRFLSSNAKSAFANMLSQADETFASIMGTLKEPLNAWINPVLDAATSADDFLLTDLR
KKKMTIYIGIQPNKLAESRLIINLLFSQIINLNTRELPKANPELKYQCLLLMDEFTSIGKVDIISTAVAY
MAGYNIRLLPIIQSMAQLDATYGKDLSRTIITNHALQILYAPREQQDANDYSEMLGYTTIKKKNVTRGRE
TTHSVSEERRALMLPQELKAMGNEKEVFLYEGIPHPVKCDKIRYYEDRYFTVRLLPKVGVATLTIKF
 
Nucleotide Sequence: 1674 bp     [Download]
>gi|66766352|ref|NC_007086.1|:1956087-1957760 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
GTGTCCAAGCTCAAAATCGCCGCAATCGCCACCGTGGTGACGATGCTCATCGGGTATTGCCTGTCGGGCT
ACCTGACGTTGCTGCTATTGCGGCTGGATACCAAGCTGTACGCGTGGGACACCTACTATCGCTACGTCAG
CGCCATGGGTCTTCCGGAGGTTGCGCCGTACGTGACCAAGATCAAGTTGGCTGGGGCGTTCGGTTTCGGC
CTGCCGGGGATCGTCTGGGCAATCGGCATGGTGCTGCTGGTCAAGCCCAAGCAGAAGGCGCTGCATGGCG
ACGCGCGCTTTGCGGGCGCTGCCGACCTCTCCAAGCATGGGCTGTTCAAACCAAGCCCGAATGGCATCGT
AGTCGGCAAGTTCAATGGCAAGTTGGTCCGGCTCAGTGGCCAGCAGTTCGTCATCCTCGCCGCGCCGACG
CGCTCCGGTAAGGGCGTGGGCGTGGTCATTCCGAATCTGCTCGAGTACCAGGAATCGGTGGTGGTTCTGG
ACATCAAGCAGGAAAACTTCGATCTGACCAGCGGCTGGCGTGCCAGCCAGGGGCACGAGGTTTTTCTCTT
CAATCCGTTTGCGGAAGATCGCCGCACGCACCGCTGGAACCCGCTCACCTACGTGTCGGCCGATCCGGCC
TTCCGCGTCTCGGATCTGATGAGCATCGCCGCGATGCTGTACCCGGACGGTTCCGACGATCAGAAATTCT
GGGTCAGCCAGGCGCGCAACGCGTTCATGGCGTTCTCTCTTTATCTGTTCGAAAACTGGGACGAGGAGCT
GTCACTGGGCTTCCCGGGCGGGGCAGGGGCGCCTACGTTGGGCGGAATCTACCGTCTCTCGTCGGGTGAC
GGCACCGACCTCAAGAAATATCTGAAGTCGCTGTCCGAACGCAGGTTCCTCAGCAGCAACGCCAAGTCGG
CGTTTGCCAACATGCTGTCACAGGCGGATGAGACCTTCGCCTCCATCATGGGCACCCTGAAAGAGCCGCT
CAACGCCTGGATCAATCCCGTTCTGGACGCTGCTACCAGCGCCGACGATTTCCTGCTGACGGATCTGCGC
AAGAAGAAGATGACCATCTACATCGGCATCCAGCCCAACAAGCTGGCCGAGAGCCGCCTGATCATCAATC
TGCTTTTCAGCCAGATCATCAACCTCAACACCCGCGAACTACCCAAGGCCAACCCTGAGCTCAAATACCA
GTGCCTGTTGCTGATGGACGAGTTCACCTCGATCGGCAAGGTGGACATCATCTCCACTGCCGTGGCCTAC
ATGGCCGGCTACAACATCCGTCTGCTGCCCATCATCCAGAGCATGGCGCAGCTGGACGCCACCTACGGCA
AGGACCTCTCGCGCACCATCATCACCAACCACGCCCTGCAGATCCTCTACGCCCCGCGTGAGCAGCAGGA
CGCGAATGACTACTCCGAGATGCTGGGGTACACCACCATCAAGAAGAAGAACGTCACCAGAGGGCGTGAG
ACGACGCATAGCGTTTCCGAGGAGCGCCGGGCGCTGATGTTGCCGCAGGAGCTCAAGGCCATGGGCAACG
AGAAGGAAGTCTTCCTATACGAAGGAATCCCGCACCCGGTGAAGTGCGACAAGATCCGCTACTACGAAGA
CCGGTACTTCACTGTCCGGCTGTTGCCTAAGGTGGGCGTGGCGACCTTGACCATCAAATTTTGA
 Primer design