SecReT4
Protein ID: 66767956
T4SS name [ID]VirB [388]
Gene symbol-
Locus tagXC_1632
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]1958610..1959653 [+]
ProductVirB8 protein
Component typeVirB8
UniProt IDQ4UW75
KEGG IDxcb:XC_1632
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4.2e-56, Aligned region: 26..245
Protein Sequence: 347 a.a.     [Download]
>gi|66767956|ref|YP_242718.1| VirB8 protein [Xanthomonas campestris pv. campestris str. 8004]
MTDLDMLRKKVSEKDGSAQVGAAVQKAVNYEVSIADLARRSERRAWLVATVSMLITVITAGGYYYMLPLK
EKVPYLVMADAYSGTSTIAKLEANYGGRTISTSEALARSNIARFILARESFDVSTIGDRDWNTVAAMAAT
NVLAEYRTLHAGNNPLRPFNTYGRSRAIRINILSITLVGGKGKAYTGATVRFQRNVYDKTSTVTTLLDNK
IATMGFAYQDNLQMSDSLRVENPLGFRVTDYRVDSDYSALPAAPASISTQAQAAPQASVYQQQMTPGMAE
QNVAGAAGQAGSPMQQVMPTGPGSAPMQQQQPGYPGQAQPQSASQPQAQPTIQPQGMPNNVNGASGR
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|66766352|ref|NC_007086.1|:1958610-1959653 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
GTGACGGATCTAGACATGTTGCGTAAGAAGGTCAGTGAAAAGGATGGGTCCGCCCAGGTTGGCGCGGCCG
TCCAGAAGGCGGTCAATTACGAGGTGAGCATCGCTGATCTCGCGCGGCGCAGTGAAAGGCGCGCATGGTT
AGTTGCGACCGTTTCCATGTTAATCACCGTCATAACAGCTGGTGGTTACTACTACATGTTGCCGCTGAAA
GAGAAAGTGCCGTACCTTGTGATGGCTGATGCTTATTCTGGTACCAGTACTATCGCCAAGCTCGAAGCGA
ATTACGGCGGCCGCACCATCAGCACCAGTGAGGCATTGGCGCGCAGCAACATCGCGCGTTTCATCCTGGC
GCGTGAATCATTCGATGTGTCCACCATTGGTGATCGCGATTGGAACACCGTTGCAGCGATGGCAGCGACA
AATGTACTTGCCGAGTATCGCACGCTGCATGCCGGCAATAATCCACTGAGACCTTTCAATACATATGGAA
GGTCGCGCGCAATCCGGATCAATATTCTCAGTATCACCCTGGTTGGTGGCAAGGGTAAAGCATACACGGG
TGCGACCGTACGCTTTCAGCGCAATGTCTATGACAAGACATCTACTGTGACAACTTTGTTAGATAATAAA
ATTGCGACGATGGGGTTCGCCTACCAAGACAATCTGCAGATGAGCGATAGCCTTAGAGTGGAAAATCCTT
TAGGTTTCCGTGTGACTGATTATCGGGTCGATAGCGACTATTCGGCCTTGCCTGCAGCGCCGGCCTCAAT
CAGCACGCAGGCGCAGGCTGCACCACAGGCTTCCGTATATCAGCAGCAGATGACTCCAGGCATGGCTGAA
CAAAACGTAGCAGGCGCTGCGGGGCAGGCCGGCTCCCCCATGCAGCAGGTTATGCCTACGGGCCCAGGGA
GCGCGCCGATGCAACAGCAGCAGCCTGGATATCCTGGACAGGCGCAACCTCAGTCAGCCAGCCAACCTCA
AGCTCAGCCCACGATTCAACCTCAAGGGATGCCGAACAATGTCAATGGAGCAAGCGGTCGATGA
 Primer design