SecReT4
Protein ID: 66767959
T4SS name [ID]VirB [388]
Gene symbol-
Locus tagXC_1635
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]1961592..1962650 [+]
ProductVirB11 protein
Component typeVirB11
UniProt IDQ4UW72
KEGG IDxcb:XC_1635
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.9e-64, Aligned region: 34..331
FtsK_SpoIIIE [PF01580], Evalue: 3.1e-05, Aligned region: 168..201
Protein Sequence: 352 a.a.     [Download]
>gi|66767959|ref|YP_242721.1| VirB11 protein [Xanthomonas campestris pv. campestris str. 8004]
MSATTAMTIDDSPTARISNDFLDYQYSVLGILDYLNSPEVTEICINRPGELYLETINGWQRMEVPSLTFD
RARQFCTAVVNESNTGQRITDADPVVSLTFPTGQRAQFVIPPACDAGKVSITIRLPSKHTKTLEQYTSDG
FFDEVLEQAADVSEQDRELLELRRSKQYSEFFKKSVLYKKNVVVAGATGSGKTTFMKALVNHIPNEERLV
TIEDARELFISQPNSVHLLYSKGGQSASNVTAKSCMEACLRMKPDRIILAELRGDESFYFIRNCASGHPG
SITSCHAGSVEQTWDQLALMVKASNEGSGLEFEVIKRLLRMTIDIVVHIKAHAGRRFITGIDFDPARTLR
GG
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|66766352|ref|NC_007086.1|:1961592-1962650 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
GTGAGCGCGACCACGGCCATGACGATCGACGATTCGCCGACAGCGCGGATCTCGAATGATTTCCTGGATT
ATCAGTACTCCGTACTGGGAATCCTGGATTATCTGAATTCTCCCGAAGTCACGGAAATTTGTATCAATCG
TCCTGGCGAGTTGTATTTGGAAACGATCAACGGCTGGCAGCGCATGGAGGTACCGTCGCTGACCTTTGAT
CGCGCCCGACAGTTCTGCACGGCAGTCGTCAACGAGAGCAATACTGGTCAGCGCATTACCGATGCCGATC
CGGTGGTCTCATTAACGTTTCCCACTGGCCAACGCGCACAGTTCGTAATTCCGCCCGCGTGCGATGCGGG
GAAGGTCTCGATCACGATTCGCTTGCCGTCCAAACATACCAAGACGCTCGAGCAGTACACCAGCGACGGG
TTCTTCGACGAGGTGCTTGAGCAAGCTGCGGATGTCAGCGAACAAGACCGCGAACTGCTTGAGTTGCGTC
GTAGCAAGCAGTACTCCGAATTCTTCAAGAAGTCGGTACTTTACAAGAAGAATGTAGTGGTGGCCGGTGC
GACTGGTAGTGGCAAGACTACTTTCATGAAGGCTCTTGTCAACCACATTCCGAACGAAGAACGCCTGGTT
ACCATCGAGGACGCCCGCGAGCTATTCATCAGCCAGCCGAATTCGGTGCATCTGTTGTACTCGAAAGGGG
GGCAGAGTGCGAGTAATGTGACCGCTAAGAGTTGCATGGAGGCCTGCCTGCGCATGAAGCCTGATCGGAT
CATCCTTGCTGAGTTGCGTGGTGACGAATCGTTCTATTTCATCCGCAATTGTGCATCCGGCCATCCTGGT
TCAATCACCAGCTGCCACGCAGGCAGCGTGGAACAGACCTGGGACCAGCTCGCGCTCATGGTGAAGGCCT
CCAATGAAGGTTCCGGGCTGGAGTTCGAGGTTATCAAGCGGCTGCTGCGCATGACCATCGATATCGTGGT
TCACATCAAGGCGCATGCTGGGCGCCGCTTTATTACTGGGATCGACTTCGATCCGGCAAGAACACTGCGT
GGCGGCTGA
 Primer design