SecReT4
Protein ID: 66768343
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2024
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2439093..2440613 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDQ4UV38
KEGG IDxcb:XC_2024
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 5.1e-127, Aligned region: 10..491
Protein Sequence: 506 a.a.     [Download]
>gi|66768343|ref|YP_243105.1| hypothetical protein XC_2024 [Xanthomonas campestris pv. campestris str. 8004]
MTLFTTDYLEYYLTLVSWIVNNGIWAVLVSSGVFALPFVAIIVQEWLKARTEGADEGNKGVLSAARIENR
VFVAIVVVMFAGIPFIDVDLNTIQYDSSRSAQCQVSVPQPADTGWSQSFSTLNNQSAKLPVWWAFIHALS
RAVTGASVAAIPCGTDLRQMRMEIDATRIDDPMLAQEVADFSHDCYGPARAKLFMQRPQLDEDQMHDVTW
IGSRFLTDTAGYYDSYRSSTPREDWPYDSNRDAGLAQVSSGGGYPNCRQWWADGSNGLRARLLGQVDPNL
LTRLAGWAGFLSRADVDDSVIRAIASPRQQKLNQGSVYTDYGGQIDKTLPNIVTRAAGDVGMAVGGLAAF
PAMDVVRQALPMVLALLKMALVICIPLVLVVGTYDLKMVVTVSVVQFALFFVDFWFQLARWIDSTILDAL
YGWGWGWNRPHNNFDPMVGLNNAFGDMLLNFVTGTMFLVLPGFWLASLTWVGIRAGHAIQGLSDGSKSAG
QAGSKGAGALTGGKLK
 
Nucleotide Sequence: 1521 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2440613-2439093 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGACGCTTTTCACCACCGACTACCTGGAGTACTACCTCACCCTTGTCTCCTGGATCGTCAATAACGGCA
TCTGGGCCGTGTTGGTATCCAGCGGGGTATTTGCGCTGCCCTTTGTGGCGATCATCGTGCAGGAATGGCT
CAAGGCCCGCACGGAAGGTGCCGACGAAGGCAACAAGGGCGTGCTCTCGGCTGCGCGCATCGAGAACCGA
GTGTTCGTCGCCATCGTGGTAGTGATGTTTGCTGGCATCCCTTTCATCGACGTCGACCTCAACACCATCC
AGTACGACAGCTCACGCTCCGCGCAGTGCCAGGTCAGCGTGCCGCAGCCGGCCGACACAGGTTGGTCGCA
GTCCTTCTCGACCCTCAACAATCAAAGCGCAAAGTTGCCGGTGTGGTGGGCCTTCATCCACGCGCTCTCG
CGCGCTGTCACGGGCGCTTCTGTCGCGGCAATCCCCTGCGGCACCGACCTGCGGCAGATGCGGATGGAGA
TTGACGCCACGCGCATCGACGATCCAATGCTGGCCCAGGAAGTGGCGGATTTCAGCCACGATTGCTACGG
GCCGGCCCGTGCCAAGCTGTTCATGCAGCGCCCGCAACTTGATGAAGACCAGATGCACGATGTCACCTGG
ATCGGCTCGCGCTTCTTGACGGACACGGCCGGCTACTACGACAGCTATCGCTCCAGCACGCCGCGCGAGG
ACTGGCCCTACGACAGCAACCGAGATGCAGGGCTTGCGCAGGTGTCCAGCGGCGGCGGATACCCGAACTG
TCGGCAATGGTGGGCCGATGGCAGCAACGGCCTGCGGGCACGGCTGCTGGGCCAGGTGGACCCAAACCTG
CTCACGCGGCTGGCGGGCTGGGCTGGGTTCCTGAGCCGCGCCGACGTGGATGATTCGGTGATTCGCGCGA
TCGCCTCGCCGCGACAACAGAAGCTCAATCAGGGCTCGGTCTATACGGACTACGGGGGCCAGATCGACAA
GACTTTGCCGAACATCGTGACGCGCGCGGCAGGCGACGTGGGAATGGCCGTTGGGGGACTCGCAGCATTC
CCCGCCATGGACGTGGTGCGCCAGGCCCTGCCCATGGTGCTCGCGCTGCTCAAGATGGCGTTGGTGATCT
GCATTCCTCTGGTATTGGTCGTGGGCACCTACGACCTCAAGATGGTCGTCACGGTCAGCGTCGTGCAGTT
CGCGCTGTTCTTCGTCGATTTTTGGTTCCAGTTGGCCCGCTGGATCGACAGCACCATCCTCGATGCGCTC
TATGGATGGGGCTGGGGATGGAACCGGCCGCACAATAACTTCGATCCGATGGTCGGATTGAACAATGCCT
TCGGCGACATGCTTCTGAACTTCGTCACCGGGACGATGTTCCTGGTCCTGCCGGGATTCTGGCTGGCGAG
CCTCACCTGGGTTGGGATTCGGGCCGGACATGCCATCCAAGGACTCTCAGATGGCAGCAAAAGCGCAGGT
CAAGCGGGTAGCAAGGGTGCTGGAGCACTCACCGGGGGCAAGCTGAAATAG
 Primer design