SecReT4
Protein ID: 66768345
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2026
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2440973..2442367 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDQ4UV36
KEGG IDxcb:XC_2026
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 464 a.a.     [Download]
>gi|66768345|ref|YP_243107.1| hypothetical protein XC_2026 [Xanthomonas campestris pv. campestris str. 8004]
MKRPELMNLSTKARRLLRTTALAGALALGCGLAWAQNGFQASGPVIGDEVMYSIGGGSAVSMGRAAGMRS
IGVGAGWNSNLICGDMNIQTTLKNQLNGVTNGFQQIMSNVIQSATSAVASLPALIIQRADPGLYNLLTNG
VLQARLDFDRSKLTCRAMAEKMAETAGGQLGWSQMAQGMALRDAVSSTDAVSAIEQAETKRGNDGVPWVG
GSNAGGAGQPAIRVVGDVTRAGYNLVNGRSVTDTSSIAQASCASLSCQTWTSPQQAVEWATRVLGEKEQR
ICDACTKTETVPGVGLTPLIQEEYEAKLEALQELISGTRNTTFENLRVAGSTSLPITRGVIEALRDEPDQ
DLLARRLASEVALSSVLEKALLLQRTLLTGKKEPNVAANELAVEAVNHESDTLDREIQNLKTELELRREL
ANNSPMAIIQRHGTRAAGSRGIYEGDPVPDRLDQLQKGNPGVRP
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2442367-2440973 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGAAGCGTCCTGAACTGATGAATCTCTCTACCAAGGCACGCCGCCTGCTGCGCACCACGGCGCTGGCCG
GCGCGCTTGCCCTGGGCTGCGGCCTCGCATGGGCGCAGAACGGCTTCCAGGCCAGCGGCCCCGTCATCGG
CGATGAGGTCATGTATTCGATTGGTGGTGGCAGCGCGGTGTCCATGGGCCGCGCGGCAGGCATGCGTTCG
ATCGGAGTCGGTGCGGGCTGGAACAGCAACCTGATCTGCGGCGACATGAACATCCAGACCACGCTGAAGA
ACCAGCTCAACGGTGTCACGAACGGCTTTCAGCAGATCATGAGCAACGTGATCCAGAGTGCTACCAGCGC
CGTGGCATCCCTGCCTGCGCTGATCATCCAGCGCGCCGATCCAGGCTTGTACAACCTGCTCACAAATGGC
GTGCTGCAGGCGCGGCTGGACTTCGACCGCTCGAAGCTGACGTGCCGCGCCATGGCCGAGAAGATGGCCG
AGACGGCCGGCGGCCAGCTTGGCTGGAGCCAGATGGCACAAGGCATGGCGCTGCGCGATGCGGTGTCTAG
CACGGATGCCGTGTCGGCGATCGAGCAAGCGGAAACCAAGCGCGGCAATGACGGCGTGCCCTGGGTGGGC
GGCAGCAATGCCGGTGGCGCGGGCCAGCCGGCCATCCGAGTGGTCGGCGATGTCACTCGGGCGGGCTACA
ACCTGGTCAATGGCCGCAGCGTGACCGACACGTCATCCATCGCCCAAGCGAGTTGCGCAAGCCTGTCCTG
CCAGACCTGGACCTCGCCGCAACAGGCGGTCGAATGGGCGACGCGGGTCCTGGGCGAGAAAGAGCAGCGC
ATCTGCGATGCCTGCACCAAGACCGAGACAGTGCCCGGTGTGGGGCTCACGCCGCTGATCCAGGAGGAGT
ACGAGGCGAAGTTGGAAGCCTTGCAGGAGCTGATCTCGGGGACGCGCAACACGACGTTCGAGAACCTGCG
CGTGGCTGGCAGCACCTCGCTGCCCATCACGCGCGGCGTCATCGAGGCGCTACGCGACGAGCCCGATCAA
GACCTGCTGGCGCGGCGGCTGGCGTCCGAGGTGGCGCTGTCGTCCGTGCTGGAGAAAGCTCTGCTGCTCC
AGCGGACCCTGCTGACGGGCAAGAAGGAGCCCAACGTCGCCGCCAATGAACTCGCGGTGGAGGCCGTGAA
CCACGAGAGCGACACGCTCGACCGCGAGATCCAGAACCTGAAGACCGAGCTGGAACTGCGCCGCGAGCTG
GCCAACAACTCGCCGATGGCCATCATCCAGCGCCACGGCACGCGTGCGGCGGGTTCGCGTGGCATCTACG
AGGGTGATCCGGTGCCTGACCGTCTCGACCAGTTGCAGAAGGGCAATCCGGGAGTCCGGCCATGA
 Primer design