SecReT4
Protein ID: 66768346
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2027
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2442378..2443343 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDQ4UV35
KEGG IDxcb:XC_2027
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.1e-95, Aligned region: 33..309
Protein Sequence: 321 a.a.     [Download]
>gi|66768346|ref|YP_243108.1| hypothetical protein XC_2027 [Xanthomonas campestris pv. campestris str. 8004]
MIRPFDPLRRLRVAVASLLLVSATASYALNTATIVGSVASPDCLEYRVVGICYWLYCTVSGCTVRTSVKV
RHYIPDAVVSSYNNTGENPWTDVRAMSASNATARAGGDGITNDDHENNLARFKNADVIGHPGGEVFNQFA
SSSGYFCEGAGMAFMPYLLSTLDTLAWRYNVPEMAYPEALTPGIREIGARSTSNLWGNVYPRGGFLHQTD
DHKAGAVVAQRAGDVVTRRGQVHVYQPLLANSRPGYWPAGALMEGNASTGKWQELTPALSSSCTVFPRGG
SLIQATQTTQAQQGDYAWALWRPYVCCERRGQVFLGSVDFD
 
Nucleotide Sequence: 966 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2443343-2442378 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
GTGATCCGCCCATTCGACCCGTTGCGCCGCCTGCGTGTCGCGGTGGCCTCGCTGCTGCTGGTCAGCGCCA
CAGCGAGCTACGCATTGAATACCGCAACCATCGTCGGTTCAGTGGCATCGCCAGATTGCCTGGAGTACCG
GGTGGTGGGCATCTGCTACTGGCTCTACTGCACTGTAAGCGGCTGCACGGTGCGCACGTCCGTCAAAGTG
CGCCACTACATTCCCGATGCGGTCGTCTCCAGCTACAACAACACTGGCGAAAATCCTTGGACCGATGTGC
GTGCGATGAGCGCCTCCAACGCGACAGCTCGCGCGGGTGGTGACGGCATCACTAACGACGACCACGAGAA
CAATCTCGCACGATTCAAGAACGCCGATGTCATCGGCCATCCCGGCGGCGAGGTGTTCAACCAGTTCGCG
TCGTCTTCGGGCTATTTCTGCGAGGGCGCTGGCATGGCGTTCATGCCGTATCTGCTCAGCACCCTGGACA
CACTGGCCTGGCGCTACAACGTGCCCGAGATGGCTTACCCGGAGGCGCTGACCCCGGGCATTCGCGAGAT
CGGCGCGCGCTCGACGTCGAACCTCTGGGGCAACGTCTATCCGCGCGGCGGCTTCCTGCACCAGACGGAC
GACCACAAGGCTGGTGCCGTGGTGGCCCAACGCGCGGGGGATGTGGTCACGCGCCGCGGGCAGGTCCATG
TCTATCAGCCGCTGCTGGCAAACTCGCGGCCCGGCTACTGGCCTGCCGGCGCGCTGATGGAGGGTAATGC
CTCGACCGGCAAGTGGCAGGAACTCACGCCCGCGCTGTCCTCGTCCTGCACGGTCTTCCCGCGCGGCGGC
TCCCTGATTCAAGCCACTCAAACCACTCAAGCCCAGCAAGGCGACTACGCCTGGGCGCTGTGGCGGCCCT
ATGTGTGCTGCGAACGCCGGGGCCAGGTGTTCCTCGGCAGCGTCGATTTCGATTGA
 Primer design