SecReT4
Protein ID: 66768347
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2028
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2443340..2443786 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDQ4UV34
KEGG IDxcb:XC_2028
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 2.2e-40, Aligned region: 35..146
Protein Sequence: 148 a.a.     [Download]
>gi|66768347|ref|YP_243109.1| hypothetical protein XC_2028 [Xanthomonas campestris pv. campestris str. 8004]
MPASFLRFAPGLRALGLAVVLPASLVAFSPATLATDVLVITDSRHPVRTMGGERLIELDEAPRIEAELSA
ALPADPDQATAIARRRLNQGGADLQHRIASAYQGVTDAWSLGITSIPAVVVDRRYVVYGEPDVARAIARI
EQHRRTQP
 
Nucleotide Sequence: 447 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2443786-2443340 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGCCAGCATCTTTTCTCAGGTTCGCGCCAGGCTTGCGAGCCCTTGGATTAGCCGTCGTGCTGCCTGCGT
CCTTGGTGGCATTCAGCCCGGCCACACTGGCTACCGATGTGCTGGTCATCACCGACAGCCGTCATCCGGT
CAGGACCATGGGCGGCGAGCGGCTGATCGAGCTGGACGAAGCGCCGCGGATCGAAGCTGAGCTTTCTGCG
GCACTGCCCGCCGATCCCGATCAGGCAACAGCCATCGCCAGGCGCCGGTTGAACCAAGGCGGTGCCGACC
TTCAGCACCGCATCGCTTCCGCATACCAAGGCGTCACCGACGCATGGAGCTTGGGCATCACCAGCATCCC
GGCCGTCGTGGTGGACCGGCGCTATGTGGTCTATGGCGAGCCTGACGTGGCGCGTGCCATCGCGCGAATC
GAACAGCATCGGAGGACACAGCCGTGA
 Primer design