SecReT4
Protein ID: 66768350
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2031
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2445406..2448270 [-]
ProductType IV secretory pathway, VirB4 components
Component typeTfc16
UniProt IDQ4UV31
KEGG IDxcb:XC_2031
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7.7e-68, Aligned region: 61..335
AAA_10 [PF12846], Evalue: 3.7e-45, Aligned region: 529..866
Protein Sequence: 954 a.a.     [Download]
>gi|66768350|ref|YP_243112.1| Type IV secretory pathway, VirB4 components [Xanthomonas campestris pv. campestris str. 8004]
MRWKLPWPKLAAAANGNDEPSDGWLRHVEALRQAGLPEPGAAVQGHRPATVADEQALYDVAPSFVELLPW
VEFLPESKSMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQDSFDELDENPWVLQLYAQDEP
SFDQYMQTLRDYVRPSARDTAFTEFYLRFFSHHLRAVAKPGGLFEDTVVTRLRWRGQTRRVRMVVYRRSI
GQTSRRGQTPEQMLNIVCDRLCGGLANAGIEARRMVAADIHDWLLRWFNPNPKLLGPGAEDRERFFALAR
YPDKAEDGEIELASGRDFSQRMFFGQPRSDVAQGAWYFDGMPHRVLVTDRLRMPPGTGHLTGETRKGDAI
NTLFDQMPEDTLMCLTMVATPQDVLESDLNHLARKAVGETLASEQTLKDVHEARSMIGSAHKLYRGSLAF
YLRGHDEAELDRRGLDLANVMLNAGLQPVREEDEVAPLNSYLRWLPCCYNPGLDRKKWYTQLMFAQHAAN
LSPVWGRSQGTGHPGITMFNRGGGPITFDPLNRFDRQMNAHLFLFGPTGSGKSATLNNLLNQVTAIYRPR
LFIVEAGNSFGLFAEFARKLGLTVHRVKLAPGVDVSLAPFADARRLIETPSDVQTLDADALDEDRPPDAT
EADEQRDVLGELEITARLMITGDEDKEEARMTRADRSLIRQCILDAAEHCVADGRTVLTRDVRNALRTRG
QDPTLPETRRVRLLEMADAMDMFCQGNDGEMFDRPGTPWPEADITLVDLATYAREGYNAQLSIAYISLIS
TVNNIAERDQYLGRPIVNVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDLPRAAEPMLNM
IEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKNMEVLFRAVPPSLYLALAQTE
PEEKAERYQLMQQFGISELDAAFKVAEKIDQARGIESPGLDQPQ
 
Nucleotide Sequence: 2865 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2448270-2445406 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGCGGTGGAAACTCCCTTGGCCCAAGCTGGCCGCCGCAGCAAACGGAAACGACGAGCCGTCTGACGGAT
GGCTGCGCCATGTCGAGGCCTTGCGCCAAGCTGGCCTGCCCGAACCCGGTGCTGCGGTCCAGGGCCACAG
GCCGGCGACCGTGGCCGACGAGCAGGCGCTGTACGACGTTGCGCCGTCCTTTGTGGAACTGCTGCCCTGG
GTGGAGTTCCTGCCCGAGTCGAAGTCGATGCTGCTGGAGGACGGGCAATCGGTGGCAGCCTTCTATGAGC
TGGTGCCGTTGGGCACCGAGGGCCGGGAACCCGGCTGGCTCGCGCATGCCCGCGACGCGTTGGAGAATGC
GCTCCAGGACAGCTTCGATGAACTGGATGAGAACCCTTGGGTGCTCCAGCTCTACGCCCAGGACGAGCCC
AGCTTCGACCAGTACATGCAGACCCTGCGCGACTACGTGCGGCCGAGTGCCCGCGATACGGCATTCACCG
AGTTCTACCTACGCTTCTTCAGCCATCACCTGCGCGCGGTGGCCAAGCCGGGCGGCCTGTTCGAGGACAC
CGTGGTCACGCGGCTGCGCTGGCGCGGCCAGACTCGGCGTGTACGGATGGTGGTCTATCGCCGTTCCATC
GGACAGACGAGCCGCCGTGGTCAGACCCCGGAGCAGATGCTCAACATCGTCTGCGACCGCCTGTGCGGAG
GACTGGCGAACGCTGGCATCGAGGCCCGGCGCATGGTCGCCGCAGACATTCACGACTGGCTACTGCGGTG
GTTCAACCCGAATCCCAAGTTGCTTGGTCCTGGTGCCGAGGACCGCGAGCGCTTCTTCGCGCTGGCGCGC
TACCCCGACAAAGCTGAGGACGGCGAGATCGAACTGGCGAGCGGGCGGGATTTCAGCCAGCGGATGTTCT
TTGGGCAACCACGTTCCGACGTCGCGCAAGGCGCTTGGTATTTCGACGGGATGCCGCACCGCGTGCTCGT
CACTGACCGGCTTCGCATGCCACCGGGCACGGGGCACTTGACCGGCGAAACCCGCAAGGGCGATGCGATC
AACACGCTGTTCGACCAGATGCCCGAAGACACGTTGATGTGCCTGACGATGGTCGCCACGCCGCAGGACG
TCCTCGAATCAGACCTGAACCACTTGGCGAGAAAGGCTGTGGGCGAGACGCTTGCGTCCGAGCAGACGCT
CAAGGATGTGCATGAGGCGCGCTCGATGATCGGCAGCGCGCATAAGCTCTACAGAGGCAGCTTGGCGTTC
TATCTGCGTGGGCACGATGAAGCAGAACTGGACCGGCGCGGCCTCGATCTCGCGAACGTGATGCTCAACG
CCGGCTTGCAGCCGGTGCGCGAGGAAGACGAGGTGGCGCCGCTCAACAGCTATCTGCGCTGGCTGCCGTG
TTGCTACAACCCTGGCCTGGATCGGAAGAAGTGGTACACGCAACTGATGTTCGCGCAGCATGCCGCGAAC
CTATCGCCGGTGTGGGGGCGCAGCCAGGGCACAGGGCATCCCGGCATCACGATGTTCAATCGCGGCGGCG
GGCCGATCACCTTCGATCCCCTCAACAGGTTTGACAGGCAGATGAATGCCCACCTCTTCCTGTTCGGACC
GACGGGTTCGGGCAAGTCAGCCACGCTCAACAACCTGCTGAACCAGGTCACGGCGATCTACCGGCCGCGC
CTGTTCATCGTGGAGGCTGGCAACAGCTTCGGGCTGTTCGCCGAGTTCGCGCGCAAGCTCGGACTGACTG
TCCACCGCGTGAAGCTCGCACCCGGGGTGGACGTGAGCCTAGCTCCCTTTGCTGACGCACGTCGCCTGAT
CGAGACGCCGAGCGACGTGCAGACGCTCGATGCCGATGCGCTGGACGAGGACCGGCCACCCGACGCCACA
GAGGCGGACGAGCAGCGCGACGTGCTAGGCGAACTGGAAATCACCGCACGCCTCATGATCACCGGCGACG
AGGACAAAGAGGAGGCGCGCATGACGCGCGCGGATCGCTCGCTGATCCGTCAGTGCATCCTCGATGCGGC
CGAGCACTGCGTGGCCGATGGGCGCACGGTACTCACGCGCGACGTGCGCAACGCGCTTCGCACCCGCGGC
CAGGACCCGACGTTGCCGGAAACGCGGCGCGTGCGCCTACTGGAAATGGCCGACGCAATGGACATGTTCT
GCCAGGGCAACGATGGCGAGATGTTCGACCGGCCCGGCACGCCGTGGCCCGAGGCCGACATCACGCTGGT
TGATCTCGCCACCTATGCCCGCGAAGGCTACAACGCGCAGCTCTCCATCGCCTACATCAGTCTGATCAGC
ACCGTCAACAACATCGCCGAGCGCGACCAATACCTCGGGCGGCCGATCGTCAACGTGACCGATGAAGGGC
ACATCATCACCAAAAATCCGCTGCTTGCCCCTTACGTCGTGAAGATCACGAAGATGTGGCGCAAGTTGGG
CGCTTGGTTCTGGTTGGCGACACAGAACATCGACGACTTGCCGCGTGCCGCGGAGCCCATGCTCAACATG
ATCGAATGGTGGATCTGCCTGTCGATGCCACCGGACGAGGTGGAGAAGATTGCGCGCTTCCGCGAACTCT
CGCCCGCGCAGAAGGCATTGATGTTGTCAGCCCGCAAGGAAGCCGGCAAGTTCACCGAGGGCGTCATCCT
GTCCAAGAACATGGAAGTGCTCTTCCGGGCCGTGCCACCGAGCCTTTACCTCGCCCTCGCGCAAACCGAA
CCCGAGGAAAAAGCCGAGCGCTACCAGCTCATGCAGCAGTTCGGCATCAGCGAGTTGGACGCCGCCTTCA
AGGTGGCCGAGAAGATTGACCAGGCGCGCGGCATTGAGTCGCCGGGCCTGGACCAGCCCCAATAG
 Primer design