SecReT4
Protein ID: 66768351
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2032
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2448270..2448713 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDQ4UV30
KEGG IDxcb:XC_2032
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 147 a.a.     [Download]
>gi|66768351|ref|YP_243113.1| hypothetical protein XC_2032 [Xanthomonas campestris pv. campestris str. 8004]
MLSNLTKGLASALLLALLGGCATSKEDLLTHGDRSMMDIWQQETGDGAVGGAGQVAHRLLLDARQSLRRP
LTDADVQAAPAEQMRYTRTARNEVYRQFQRLPNPDLVMYVFPHLAGTDPVPVPGYSTVFPLYQRIQYAMP
GERVEDY
 
Nucleotide Sequence: 444 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2448713-2448270 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGCTCTCGAACTTGACTAAGGGCCTTGCGTCGGCCCTCCTCCTCGCGCTGCTGGGCGGCTGCGCCACCA
GCAAGGAGGATCTGCTGACCCACGGCGACCGCTCGATGATGGATATCTGGCAGCAGGAAACCGGCGACGG
CGCGGTGGGTGGTGCCGGCCAGGTGGCTCACCGCCTGCTGCTCGACGCGCGCCAGAGCCTGCGTCGGCCG
CTGACCGACGCCGACGTGCAGGCCGCACCCGCCGAGCAGATGCGCTACACGCGCACGGCGCGCAACGAGG
TCTATCGCCAGTTCCAGCGCCTGCCCAATCCCGACCTGGTGATGTACGTATTCCCCCATTTGGCCGGCAC
GGACCCCGTGCCGGTTCCGGGCTACAGCACCGTGTTTCCGCTGTACCAACGCATCCAATACGCCATGCCG
GGCGAGCGCGTGGAGGACTACTGA
 Primer design