SecReT4
Protein ID: 66768352
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2033
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2448694..2450124 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDQ4UV29
KEGG IDxcb:XC_2033
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 476 a.a.     [Download]
>gi|66768352|ref|YP_243114.1| hypothetical protein XC_2033 [Xanthomonas campestris pv. campestris str. 8004]
MRSNGLLKWLMIPVALLVLFFGIRLFSGGGSSAPSQAETGSQLTPEEMKALGIAGDTPRDTVATLVAQVK
QLRTELQTALSDNKSQREENQRLRQRENSIDQRINSALETERSNLRRDQQQAASERQQTEGLLADLQQRL
DSIGGRGGGHTDMPVGLGLRDGDEAGMEGGMRWVDPDDKKPVDGRNGNRGTGGGNNFPTSFGPAQSTLDT
TAETVPKASEGSARAKSTKPVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGID
IPDVAGAVFSGTASGDWTLSCVRGQVRSITFVFHDGTIRTIPEDREGNQQNNQQQNAQSGGLGWISDPYG
IPCVGGERRSNAQQYIGSQALITAAGAGVASLIQSDSGQMSYVGSDGSIGTVGISGQEAVGRILAGGVKE
MSNWVNKLYGQAFAAVYVQPGAKVAVHLDKPLAIDFDPEGRKVDHRAGENHALELD
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2450124-2448694 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGCGCAGTAACGGACTCCTGAAGTGGCTGATGATTCCTGTGGCCCTGCTGGTGCTGTTCTTCGGCATTC
GGCTGTTCTCGGGCGGAGGGTCGTCGGCACCCTCGCAAGCCGAGACGGGTAGCCAACTCACGCCCGAAGA
AATGAAGGCATTGGGCATTGCAGGCGATACCCCGCGCGACACCGTGGCAACGCTCGTCGCCCAGGTAAAG
CAACTGCGCACCGAGCTTCAGACCGCGCTGTCTGATAACAAGTCCCAGCGCGAGGAGAACCAGCGGCTGC
GCCAGCGCGAGAACTCGATCGACCAGCGCATCAACTCGGCGCTGGAGACCGAGCGCTCCAACCTGCGCCG
CGACCAGCAACAGGCGGCCAGTGAACGCCAGCAGACCGAGGGCCTGCTCGCCGACTTGCAGCAGCGTCTG
GACAGCATCGGCGGACGCGGGGGCGGCCATACAGATATGCCTGTGGGCCTGGGGCTGCGCGACGGCGACG
AGGCCGGAATGGAAGGCGGCATGCGCTGGGTGGATCCAGACGATAAGAAGCCCGTCGATGGACGCAATGG
CAACCGTGGCACGGGTGGCGGCAACAACTTCCCGACGAGCTTCGGCCCGGCGCAGAGCACGCTGGACACC
ACGGCGGAAACCGTGCCGAAGGCGAGTGAGGGCTCCGCCCGGGCCAAAAGCACCAAACCCGTCTATACCG
TGCCGACGAACTCGACGCTCATGGGGTCGGTGGCGATGACGGCGCTGATTGGCCGCGTCCCGATCGACGG
AACCGTGAACGATCCGTACCCCTTCAAAGTCCTCGTCGGCCCCGACAATCTCACCGCCAACGGCATCGAC
ATTCCTGACGTGGCCGGTGCGGTCTTCAGCGGCACGGCTTCGGGGGACTGGACGCTGTCATGCGTGCGCG
GCCAGGTGCGCAGCATCACCTTCGTCTTTCATGATGGAACGATCCGCACGATCCCCGAGGACCGCGAGGG
CAATCAGCAGAACAACCAGCAGCAGAACGCTCAAAGTGGGGGCCTGGGCTGGATCAGTGATCCCTACGGC
ATCCCGTGCGTCGGCGGAGAGCGGCGCAGCAATGCGCAGCAGTACATCGGCTCGCAAGCCCTCATCACGG
CGGCCGGCGCCGGCGTGGCCTCGCTCATCCAAAGCGACAGCGGCCAGATGTCCTACGTGGGCTCGGACGG
CTCTATTGGCACCGTGGGCATCAGCGGTCAGGAAGCGGTCGGCCGGATTCTCGCAGGCGGTGTCAAGGAG
ATGTCGAACTGGGTCAACAAGCTGTACGGCCAGGCATTCGCCGCAGTGTATGTCCAGCCCGGCGCCAAAG
TCGCCGTCCACCTCGACAAGCCGCTCGCCATCGACTTCGATCCCGAAGGTCGCAAGGTTGATCACCGCGC
AGGAGAAAACCATGCTCTCGAACTTGACTAA
 Primer design