SecReT4
Protein ID: 66768354
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2035
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2451037..2451726 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDQ4UV27
KEGG IDxcb:XC_2035
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 7.1e-90, Aligned region: 6..206
Protein Sequence: 229 a.a.     [Download]
>gi|66768354|ref|YP_243116.1| hypothetical protein XC_2035 [Xanthomonas campestris pv. campestris str. 8004]
MSRFKNEITHLQAHIKTLRLGAGALVIVALVMGGGWWSAPRDLTIHVPPDLRSGSTRKWWEVPPESVYSF
TFYVFQQLNRWPTNGEEDYPRNLHALSPYLTPSCHAFLRADFDYRRSTGELRQRVRGIYEIPGRGYGDDP
NARVRVVSDRDWVVTLDISADEYYGAEQVKRALVRYPIKVTRVDVDPSHNPFGLALDCYDGTPQRISAPE
ASRPAAGGLSPQAPQGETP
 
Nucleotide Sequence: 690 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2451726-2451037 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGAGCCGCTTCAAGAACGAGATCACCCACCTGCAGGCGCATATCAAGACGCTGCGACTGGGCGCTGGCG
CGCTGGTAATCGTCGCCCTCGTAATGGGCGGTGGCTGGTGGAGCGCACCGCGCGACCTGACGATCCACGT
CCCGCCGGACTTGCGCTCGGGGAGCACCCGCAAGTGGTGGGAAGTGCCGCCCGAATCGGTCTACTCCTTC
ACGTTCTACGTGTTCCAGCAATTGAATCGCTGGCCAACCAATGGCGAAGAAGACTATCCGCGCAACCTGC
ACGCGCTCTCGCCGTACCTCACACCGTCCTGCCACGCCTTTCTGCGTGCAGACTTCGATTACCGGCGCAG
CACGGGCGAACTGCGGCAACGCGTGCGCGGCATCTATGAAATCCCTGGCCGCGGCTATGGCGATGATCCC
AACGCCCGCGTGCGCGTGGTCTCCGACCGCGACTGGGTGGTGACGCTGGACATCAGCGCCGACGAGTACT
ACGGCGCCGAGCAGGTCAAGCGCGCCCTGGTGCGCTACCCCATCAAAGTCACGCGGGTGGACGTCGACCC
CTCGCACAACCCGTTCGGCTTGGCACTGGACTGCTACGACGGCACGCCCCAGCGCATCAGCGCACCGGAA
GCCTCCCGCCCAGCGGCTGGCGGCCTGTCTCCGCAAGCGCCCCAAGGAGAAACACCATGA
 Primer design