SecReT4
Protein ID: 66768355
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2036
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2451723..2452133 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDQ4UV26
KEGG IDxcb:XC_2036
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.4e-48, Aligned region: 10..133
Protein Sequence: 136 a.a.     [Download]
>gi|66768355|ref|YP_243117.1| hypothetical protein XC_2036 [Xanthomonas campestris pv. campestris str. 8004]
MSEHQHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLSGGAGLLVGAPLSWVFRTIALAPTFVVLG
VAFGVFIGGGILRRLKRGRPDTWLYRQLQWRITMRHPLAANWVGGRTLISHSGFWSTRRSMPRGAR
 
Nucleotide Sequence: 411 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2452133-2451723 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGTCCGAACACCAGCACGTCCGTGCCGACGGGACGGTGACGTTCCTTCCGCACCGGCTCAACCGCCATC
CCGTTGTTGTGCGTGGACTCACCGCCGACGAGCTGTGGATTTGCTGCGGTCTGTCCGGCGGCGCCGGCCT
GCTGGTCGGCGCGCCGCTGTCCTGGGTGTTCCGCACGATCGCACTCGCGCCCACGTTCGTCGTCCTGGGC
GTGGCCTTCGGCGTGTTCATCGGCGGCGGCATCCTCCGTCGACTCAAGCGTGGGCGGCCAGATACCTGGC
TGTACCGGCAGTTGCAGTGGCGGATCACCATGCGCCATCCGCTCGCAGCCAACTGGGTGGGCGGCCGTAC
GCTGATCTCGCACTCGGGCTTCTGGTCCACCCGCAGGTCCATGCCAAGGGGTGCGCGATGA
 Primer design