SecReT4
Protein ID: 66768357
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2038
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2452750..2453130 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDQ4UV24
KEGG IDxcb:XC_2038
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 1.7e-29, Aligned region: 29..109
Protein Sequence: 126 a.a.     [Download]
>gi|66768357|ref|YP_243119.1| hypothetical protein XC_2038 [Xanthomonas campestris pv. campestris str. 8004]
MVASTWLRAAHRGVPTFLLTALLMGQSPMALAESPAQRQELVAALRQLDALERTVANSAAHTPITPGERY
HFDYPRLLADLARVRVGIQDHLTPSRAQPRDSSELAGDYRTEQRTELPRTTAEGEP
 
Nucleotide Sequence: 381 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2453130-2452750 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGGTGGCTTCAACTTGGCTACGCGCCGCGCATCGCGGCGTGCCCACTTTTCTCTTGACGGCCCTCTTGA
TGGGGCAGTCCCCAATGGCGTTGGCCGAATCTCCGGCACAGCGCCAGGAACTGGTCGCCGCGCTGCGCCA
GCTTGATGCCCTGGAGCGCACCGTCGCGAACAGCGCCGCGCATACCCCCATCACACCGGGCGAACGCTAC
CACTTCGACTACCCGCGTCTCCTGGCTGATCTGGCGCGCGTGCGCGTCGGCATCCAGGACCACCTCACGC
CATCGCGTGCCCAGCCGCGTGATTCCTCCGAACTGGCCGGTGACTACCGCACCGAGCAGCGCACCGAGCT
GCCGCGGACGACCGCGGAGGGCGAGCCATGA
 Primer design