SecReT4
Protein ID: 66768358
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2039
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2453229..2453978 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDQ4UV23
KEGG IDxcb:XC_2039
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1e-69, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|66768358|ref|YP_243120.1| hypothetical protein XC_2039 [Xanthomonas campestris pv. campestris str. 8004]
MRDVASTAQREQNQSQGLIVGTLTLPFRLLAVLIGSLLFSIVVECVGMHLFWKDQGWRHSQQMLQSELGH
LSSHFTRSMVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERAHAPSNGQTRNFRYYISQVYVLTES
YLIAAAFTMLTFIVRLLVLVLTLPLIFTAAFVGLIDGLVRRDVRRFGAGRESGFIYHRAKASLMPLVVLP
WVTYLALPISVHPLLILLPSAALLGWAVSLTAGSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2453978-2453229 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGAGAGACGTCGCCTCAACCGCGCAACGAGAGCAGAACCAGAGCCAAGGCCTGATCGTCGGCACCCTTA
CGCTACCGTTTCGGCTGCTCGCGGTGTTGATCGGCTCGCTGCTGTTTTCGATCGTCGTGGAGTGTGTCGG
CATGCACCTGTTCTGGAAGGACCAGGGATGGCGCCACTCCCAGCAGATGTTGCAGTCCGAACTGGGGCAC
CTCTCCAGTCACTTCACGCGCAGCATGGTCGTGCAGGAGCCGGGGCGCACGGCGCACGAGCTGGTGGATA
CCGGCTACGAATGGGTGTTCGTGCGCTCAGGCTTGTTGGAACGGATGAGCCAGACCGCCGAGCGCGCCCA
CGCGCCAAGCAACGGACAGACGCGCAACTTTCGCTACTACATTAGCCAAGTCTACGTCTTGACCGAGAGC
TATCTGATCGCTGCTGCCTTCACGATGCTGACCTTCATCGTGCGTCTGCTGGTCCTGGTTCTCACGCTGC
CACTGATCTTCACGGCAGCATTCGTTGGTTTGATCGACGGCCTGGTGCGGCGCGACGTGCGTCGATTCGG
TGCGGGTCGGGAATCTGGCTTTATTTATCACCGGGCAAAAGCGAGCCTGATGCCGCTGGTCGTGCTGCCT
TGGGTGACCTACCTCGCGCTGCCGATCTCAGTGCACCCGTTGCTGATCCTCTTGCCCAGCGCAGCCTTGC
TGGGCTGGGCTGTGAGTCTGACCGCCGGGAGCTTCAAAAAGTACCTCTAG
 Primer design