SecReT4
Protein ID: 66768360
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2041
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2456169..2456717 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDQ4UV21
KEGG IDxcb:XC_2041
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.7e-51, Aligned region: 34..181
Protein Sequence: 182 a.a.     [Download]
>gi|66768360|ref|YP_243122.1| hypothetical protein XC_2041 [Xanthomonas campestris pv. campestris str. 8004]
MTKSHLAHLAAKGLLVLLAGLPLTSRAGESLIVVEDRGGTSALPYYEALNLQPRVNSPARPQIPTPQVPA
TPADEAAMLPVRSTKLTPGTVARRVIEAPGLRPFVVAGDDKASQDWLRRNAASLHERGAVGLVVNVETVQ
ALARLRALAPGVQMAPVAGDDLAERLGLRHYPALITATSIEQ
 
Nucleotide Sequence: 549 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2456717-2456169 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGACGAAATCCCATCTGGCCCATCTCGCGGCGAAGGGCCTGCTCGTGCTGTTGGCGGGTCTGCCGCTGA
CCTCGCGTGCCGGTGAGTCGCTGATCGTGGTCGAAGACCGTGGCGGCACGTCCGCGCTACCGTACTACGA
AGCCCTGAACCTCCAACCGCGTGTCAACTCCCCTGCCCGGCCGCAGATCCCGACGCCCCAGGTTCCCGCC
ACCCCCGCAGACGAGGCCGCGATGCTGCCGGTGCGCAGCACCAAGCTCACGCCCGGCACCGTCGCGCGGC
GAGTGATCGAGGCCCCTGGCCTTCGGCCTTTCGTGGTCGCCGGCGACGACAAGGCTTCCCAAGACTGGCT
GCGGCGCAATGCGGCCTCGTTGCACGAGCGCGGCGCGGTCGGCCTGGTGGTCAATGTCGAGACCGTGCAG
GCATTGGCGCGGCTACGCGCATTAGCGCCCGGCGTTCAAATGGCCCCCGTGGCCGGCGACGACCTGGCAG
AGCGCTTGGGCCTGCGGCACTACCCGGCGCTGATCACCGCCACCAGCATCGAGCAATGA
 Primer design