SecReT4
Protein ID: 66768361
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2042
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2456714..2457295 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDQ4UV20
KEGG IDxcb:XC_2042
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 193 a.a.     [Download]
>gi|66768361|ref|YP_243123.1| hypothetical protein XC_2042 [Xanthomonas campestris pv. campestris str. 8004]
MPVLPHLRAVVLAAGLYACAAQAQEMPPPAYQLAAQSAGIPSPVLYAVALQESGIRRHGRVVPWPWSLNI
AGQSRRYATRADACAGLQQAIRSTPHTRIDAGLGQINLGYHQQRYASACDLLDPYRNLAIAAEILQEQHT
PGENWLVAIGRYHRPAGGEPAARYRRSVSRHLARVQGTRPTTAVLAARQETSP
 
Nucleotide Sequence: 582 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2457295-2456714 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGCCCGTCTTGCCGCACCTGCGTGCAGTGGTGCTAGCTGCGGGCCTGTACGCCTGCGCCGCCCAGGCCC
AGGAGATGCCGCCGCCGGCCTACCAGCTTGCCGCGCAGAGCGCCGGCATTCCTTCGCCGGTGCTCTACGC
CGTGGCCTTGCAGGAGAGCGGCATCCGGCGCCACGGGCGCGTCGTCCCATGGCCGTGGTCCCTCAACATC
GCCGGCCAATCGCGCCGCTATGCGACCCGCGCCGACGCCTGCGCCGGTTTGCAGCAAGCCATCCGCTCCA
CGCCGCACACGCGCATCGACGCTGGCCTGGGCCAGATTAACCTCGGCTACCACCAGCAGCGCTACGCCAG
CGCGTGCGACTTGCTCGACCCGTACCGCAATCTCGCCATCGCCGCCGAGATCCTGCAAGAGCAGCACACC
CCCGGCGAAAACTGGCTGGTGGCGATCGGCCGCTACCACCGCCCCGCCGGTGGCGAGCCCGCAGCCCGCT
ATCGGCGCAGCGTGTCCCGCCACCTCGCGCGCGTGCAGGGCACGCGCCCAACCACCGCAGTCCTCGCCGC
GCGGCAGGAGACCTCCCCATGA
 Primer design