SecReT4
Protein ID: 66768362
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2043
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2457301..2458023 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDQ4UV19
KEGG IDxcb:XC_2043
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 240 a.a.     [Download]
>gi|66768362|ref|YP_243124.1| hypothetical protein XC_2043 [Xanthomonas campestris pv. campestris str. 8004]
MKHCPVLILSLLAALHLPASAQQPATAQSRNMPNQERPLAGRILDDRVARDWGLQPQDWARYRELMEGPL
GIYSPNLDPLSALGIEARTDEERRRYAELQVQVEARRVEKLLAYQRAYDEAWQRLNPGMQRVNLPDDKPG
AAVRSSGRMAVFIKDGCAACGQLVQRLQTSGTEFDLYMVGSRQEDARIRDWAKRAQIDPARVRSGSITLN
HDGGRWLSLGLTGDLPAAVREVNGQWQRQP
 
Nucleotide Sequence: 723 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2458023-2457301 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGAAACACTGTCCCGTTCTCATTCTATCGCTGCTGGCAGCGCTGCACCTGCCGGCTTCGGCCCAGCAGC
CTGCCACCGCTCAGTCCCGTAATATGCCCAACCAGGAGCGGCCCCTGGCAGGCCGCATCCTGGACGACCG
CGTGGCGCGCGACTGGGGCCTGCAACCGCAGGATTGGGCGCGCTACCGCGAGCTGATGGAGGGACCACTC
GGCATCTACTCACCGAACCTGGACCCGCTATCGGCCTTGGGAATCGAGGCCCGCACCGACGAAGAGCGGC
GGCGCTACGCAGAGTTGCAGGTGCAGGTCGAAGCGCGTCGCGTGGAGAAGCTGCTGGCGTACCAGCGCGC
CTACGACGAAGCCTGGCAGCGGCTGAACCCTGGCATGCAGCGCGTGAACCTGCCCGATGACAAACCAGGC
GCCGCCGTGCGCAGCAGCGGCCGCATGGCAGTATTCATTAAGGACGGCTGCGCCGCATGCGGGCAGCTCG
TGCAACGCCTGCAAACTTCGGGCACCGAGTTCGATCTGTACATGGTCGGCAGCCGACAGGAAGACGCGCG
TATCCGCGACTGGGCCAAGCGCGCGCAGATCGATCCAGCACGAGTGCGCAGCGGCAGCATCACGCTCAAC
CACGACGGCGGCCGCTGGCTGTCACTCGGCCTAACCGGTGATCTGCCGGCCGCCGTGCGCGAGGTGAACG
GTCAATGGCAGCGTCAGCCGTAG
 Primer design