SecReT4
Protein ID: 66768364
T4SS name [ID]Tfc [683]
Gene symbol-
Locus tagXC_2045
StrainXanthomonas campestris pv. campestris str. 8004
Repliconchromosome [GenBank: NC_007086] [Browse all T4SS(s) in this replicon]
Location [Strand]2458683..2459267 [-]
Producthypothetical protein
Component typeTfc2
UniProt IDQ4UV17
KEGG IDxcb:XC_2045
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 194 a.a.     [Download]
>gi|66768364|ref|YP_243126.1| hypothetical protein XC_2045 [Xanthomonas campestris pv. campestris str. 8004]
MCPFPLWFHHPERRLLAGTLGLLCSVLAGGCATTAAPHAPDAIKEASPAPELEAPQFIPVVRYGRYTLVE
LAPMAAQRDLLLQTVDVSMPADARATVGDGLRHVLKRSGYQLCETAHAVIELYPLPLPVAHLNLGPMTLR
NALLTLAGPSWELHVDDRTRQVCFEQVHGDATAPMPEPPATDAMQTFPLAGGQP
 
Nucleotide Sequence: 585 bp     [Download]
>gi|66766352|ref|NC_007086.1|:c2459267-2458683 Xanthomonas campestris pv. campestris str. 8004 chromosome, complete genome
ATGTGCCCTTTTCCACTCTGGTTTCATCATCCCGAACGCCGCCTGCTGGCGGGAACCCTCGGCCTGCTCT
GTTCGGTGCTGGCTGGCGGCTGCGCGACGACTGCGGCGCCGCACGCGCCCGATGCCATCAAGGAAGCCTC
GCCCGCACCGGAACTCGAGGCACCGCAGTTCATTCCGGTCGTGCGCTATGGACGCTACACCTTGGTGGAA
CTGGCCCCGATGGCGGCGCAGCGCGACCTGCTGCTGCAGACCGTCGATGTATCCATGCCCGCAGATGCAC
GCGCCACGGTCGGCGACGGACTCCGGCACGTGCTCAAGCGCAGCGGCTACCAGCTTTGCGAGACGGCGCA
CGCCGTGATCGAGCTATACCCGCTGCCGCTGCCGGTGGCGCACCTGAATCTGGGCCCCATGACCTTGCGC
AATGCGCTGCTCACTCTGGCCGGCCCGTCCTGGGAGCTGCACGTGGATGACCGCACGCGCCAAGTCTGCT
TCGAGCAGGTCCACGGCGACGCTACCGCGCCGATGCCCGAACCGCCTGCCACCGACGCGATGCAGACGTT
TCCCCTCGCGGGAGGCCAACCATGA
 Primer design