SecReT4
Protein ID: 67458855
T4SS name [ID]VirB [501]
Gene symbolvirB8_1
Locus tagRF_0463
StrainRickettsia felis URRWXCal2
Repliconchromosome [GenBank: NC_007109] [Browse all T4SS(s) in this replicon]
Location [Strand]492227..492925 [-]
ProductVirB8 protein
Component typeVirB8
UniProt IDQ4UMA3
KEGG IDrfe:RF_0463
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 5.3e-19, Aligned region: 21..222
Protein Sequence: 232 a.a.     [Download]
>gi|67458855|ref|YP_246479.1| VirB8 protein [Rickettsia felis URRWXCal2]
MDPLTNAIQEYIKSGEYFIDARKWYNFKYILPLSHRSLLLLICTIFTLLLTLVCININILLPINEKVSYL
IKDDAEKQATVTNTKHSTLANPYISVANIMLQNYVKQREEYNYDILKEQFTFIKNASTSIVYMQFANFMN
IDNPLSPVIRYQKLYRRSINILSINNINDNEAVVTFESLAQNSTGEILENMVWEARIGFIMDSISTSTSP
DMPFNFTVTSYKLKLLRNKNQK
 
Nucleotide Sequence: 699 bp     [Download]
>gi|67458392|ref|NC_007109.1|:c492925-492227 Rickettsia felis URRWXCal2 chromosome, complete genome
ATGGACCCATTAACCAACGCAATACAAGAATATATAAAATCCGGCGAATATTTTATTGATGCAAGAAAAT
GGTATAATTTTAAGTATATCTTACCGTTAAGTCATAGAAGTCTTCTGCTTTTAATATGCACGATTTTTAC
CTTATTATTAACCTTAGTTTGTATAAATATCAACATATTGCTACCAATAAACGAAAAAGTAAGTTATTTA
ATAAAAGATGATGCCGAAAAACAAGCTACCGTTACTAATACTAAACATTCAACACTCGCCAATCCTTATA
TCTCTGTTGCAAATATTATGCTTCAGAATTATGTAAAACAACGAGAAGAATATAATTACGATATATTAAA
AGAACAATTTACCTTTATCAAAAATGCTTCTACGAGTATTGTTTATATGCAATTTGCTAATTTTATGAAT
ATTGATAACCCATTATCACCGGTCATAAGATATCAAAAACTATATAGACGCTCAATTAATATATTATCAA
TTAACAATATAAACGATAACGAGGCAGTTGTTACTTTTGAATCATTGGCACAAAATAGTACGGGTGAAAT
TTTAGAAAATATGGTATGGGAAGCAAGAATCGGATTTATAATGGATTCTATCAGTACAAGTACATCACCT
GATATGCCCTTCAATTTTACCGTTACTAGTTACAAGCTAAAGTTATTAAGGAATAAAAATCAGAAATAA
 Primer design