SecReT4
Protein ID: 67458857
T4SS name [ID]VirB [501]
Gene symbolvirB8_2
Locus tagRF_0465
StrainRickettsia felis URRWXCal2
Repliconchromosome [GenBank: NC_007109] [Browse all T4SS(s) in this replicon]
Location [Strand]493616..494347 [+]
ProductVirB8 protein
Component typeVirB8
UniProt IDQ4UMA1
KEGG IDrfe:RF_0465
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.6e-44, Aligned region: 37..241
Protein Sequence: 243 a.a.     [Download]
>gi|67458857|ref|YP_246481.1| VirB8 protein [Rickettsia felis URRWXCal2]
MNNIFGFFKSSNNSKSGSGDTQNQESIKSANPLKITQNWYEERSDKLIVQRNLLIILIILLTIFMVISTL
VIAFVVKSKQFDPFVIQLNSNTGRASVVEPISSPVLTADESLTRYFIKKYITARETYNPVDFAIIARTTI
RLFSTSGVYNNYLGYIRNKDFDPTIKYKEDNTTFLVIKSWSKIAADKYIVRFSVNETSGSQLVYNKIAVV
SYAYVPMQLTDSELDINPVGFQVNGYRVDDDNS
 
Nucleotide Sequence: 732 bp     [Download]
>gi|67458392|ref|NC_007109.1|:493616-494347 Rickettsia felis URRWXCal2 chromosome, complete genome
ATGAATAATATATTTGGCTTCTTTAAATCAAGTAACAACTCGAAAAGCGGTTCAGGAGATACACAAAATC
AAGAAAGTATTAAATCGGCTAATCCTTTAAAAATTACTCAGAATTGGTATGAAGAGCGATCTGATAAGTT
AATTGTTCAACGTAACTTACTTATCATATTAATAATACTACTAACCATTTTTATGGTTATATCAACTTTA
GTAATAGCATTTGTAGTAAAATCCAAACAGTTTGATCCTTTTGTTATTCAGCTTAATAGTAATACCGGAC
GTGCCTCGGTGGTAGAACCTATTTCATCACCGGTGTTAACGGCGGATGAGTCTCTTACAAGGTATTTTAT
AAAGAAATACATAACGGCACGGGAAACATATAATCCAGTTGATTTTGCAATTATAGCTCGTACGACAATA
AGATTATTTTCAACAAGCGGTGTTTATAATAATTATCTTGGCTATATAAGAAATAAAGATTTTGATCCTA
CGATAAAATATAAAGAAGATAATACTACATTTTTAGTAATAAAATCATGGTCAAAAATCGCAGCAGATAA
ATATATAGTTAGATTTTCCGTAAATGAAACATCAGGAAGCCAATTAGTTTATAATAAAATAGCGGTAGTA
AGTTATGCTTATGTGCCTATGCAATTAACAGATTCAGAACTTGACATAAATCCGGTAGGGTTTCAAGTTA
ACGGATATAGGGTAGACGATGACAATAGTTAG
 Primer design