SecReT4
Protein ID: 67458860
T4SS name [ID]VirB [501]
Gene symbolvirB11
Locus tagRF_0468
StrainRickettsia felis URRWXCal2
Repliconchromosome [GenBank: NC_007109] [Browse all T4SS(s) in this replicon]
Location [Strand]496347..497351 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDQ4UM98
KEGG IDrfe:RF_0468
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.8e-93, Aligned region: 13..311
Protein Sequence: 334 a.a.     [Download]
>gi|67458860|ref|YP_246484.1| type IV secretion system ATPase VirB11 [Rickettsia felis URRWXCal2]
MNEEFAALETFLLPFKNLFAEDGINEIMVNKPGEAWVEKKGDIYSKQIPELDSEHLLSLGRLVAQSTEQM
ISEEKPLLSATLPNGYRIQIVFPPACEIGQIIYSIRKPSGMNLTLDEYAKMGAFDDTATESLVDEDAVIL
NNFLAEKKIKEFIRHAVVSKKNIIISGGTSTGKTTFTNAALTEIPAIERLITVEDAREVVLSSHPNRVHL
LASKGGQGRANVTTQDLIEACLRLRPDRIIVGELRGKEAFSFLRAINTGHPGSISTLHADSPAMAIEQLK
LMVMQADLGMPPEEVKKYILTVVDIVVQLKRGSGGKRYVSEVYYKKNKNAEGMV
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|67458392|ref|NC_007109.1|:496347-497351 Rickettsia felis URRWXCal2 chromosome, complete genome
ATGAATGAAGAATTTGCAGCCTTAGAGACGTTTTTACTTCCTTTTAAAAATTTATTTGCTGAAGACGGTA
TTAACGAGATTATGGTTAATAAGCCTGGGGAAGCATGGGTTGAAAAAAAAGGCGATATATATTCTAAGCA
AATACCGGAATTGGATAGTGAACATTTACTTTCATTAGGGCGTTTAGTTGCTCAATCTACCGAACAGATG
ATTTCGGAAGAAAAGCCTTTACTTTCCGCAACTTTGCCGAACGGTTATCGTATTCAAATAGTATTTCCTC
CTGCTTGTGAGATAGGACAAATCATTTATTCTATAAGAAAGCCTAGCGGTATGAATCTAACTTTAGATGA
ATATGCTAAAATGGGAGCATTTGATGATACTGCAACAGAGAGTTTAGTAGATGAAGATGCAGTAATTTTA
AATAATTTCTTAGCCGAAAAAAAGATTAAAGAATTTATTAGACATGCAGTTGTTTCAAAGAAAAATATCA
TAATTAGCGGCGGTACTTCAACCGGTAAAACTACTTTTACTAATGCGGCACTTACTGAAATACCTGCAAT
AGAAAGATTAATTACTGTAGAAGATGCTCGTGAGGTTGTGCTATCAAGCCATCCTAACAGAGTGCATTTA
CTTGCTTCCAAAGGAGGACAGGGGCGTGCAAATGTTACTACTCAAGATTTAATAGAGGCGTGTTTGCGTT
TAAGACCGGATAGAATTATAGTGGGTGAGCTTCGAGGTAAGGAAGCTTTTAGTTTTTTGCGTGCTATTAA
TACAGGTCACCCCGGTTCAATATCAACACTGCATGCGGATAGTCCCGCTATGGCTATTGAGCAGTTAAAG
CTTATGGTTATGCAAGCAGATCTTGGTATGCCGCCTGAAGAAGTAAAGAAGTATATTTTAACCGTTGTAG
ATATCGTTGTGCAGTTAAAACGCGGTAGCGGTGGGAAAAGATATGTTTCGGAGGTTTACTATAAGAAGAA
TAAGAATGCTGAGGGTATGGTGTAG
 Primer design