SecReT4
Protein ID: 67458861
T4SS name [ID]VirB [501]
Gene symbolvirD4
Locus tagRF_0469
StrainRickettsia felis URRWXCal2
Repliconchromosome [GenBank: NC_007109] [Browse all T4SS(s) in this replicon]
Location [Strand]497672..499447 [+]
Producttype IV secretion system protein VirB8
Component typeVirD4
UniProt IDQ4UM97
KEGG IDrfe:RF_0469
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.6e-165, Aligned region: 120..567
TraG-D_C [PF12696], Evalue: 1.9e-28, Aligned region: 404..526
TrwB_AAD_bind [PF10412], Evalue: 8.2e-22, Aligned region: 237..535
AAA_10 [PF12846], Evalue: 1.8e-05, Aligned region: 155..481
Protein Sequence: 591 a.a.     [Download]
>gi|67458861|ref|YP_246485.1| type IV secretion system protein VirB8 [Rickettsia felis URRWXCal2]
MEWHKILKVTRNIFGHAIIHPVVIFCTIWISGAFVAIFTNEVGALGVDINAINIAYKWAYWLINVWGQLK
IADYNYLKLKLLASLLGPAIVVIIFYIKNFERIKSLQFFEQPEKVYGDASWANPSDIEAAGLRSKKGMLI
GVDAGGYFVADGFQHALLFAPTGSGKGVGFVIPNLLFWSDSVVVHDIKLENHGLTSGWREKQGQKVFVWE
PSNPDGITHCYNPIDWVSTKPGQMVDDVQKISNLIMPEKDFWNNEARSLFLGVTLYLIADPTKTKSFGEV
VRTMRSDDVVYNLAVVLDTLGGVIHPVAYMNIAAFLQKADKERSGVISTMNSSLELWANPLIDSATASSD
FNVQEFKKVKTTVYVGLTPDNIQRLQKLMQVFYQQATEFLSRKMPDLKEEPHGVMFLLDEFPTLGKMDTF
KAGIAYFRGYRVRLFLIIQDTQQLKGTYEDAGMNSFLSNATYRITFAANNYETANLISQLVGNKTVEQRS
FSKPLFFDLNISTRTQNVSQVQRALLLPQEVIQLPRDEQIVLIESFPPIKSRKIKYYEDKFFTSRLLPPT
FVPTQVPFDPRANNNEAQEETETTTAPENNE
 
Nucleotide Sequence: 1776 bp     [Download]
>gi|67458392|ref|NC_007109.1|:497672-499447 Rickettsia felis URRWXCal2 chromosome, complete genome
ATGGAATGGCATAAGATACTTAAAGTTACTAGGAATATATTCGGTCATGCTATAATTCATCCGGTTGTTA
TTTTTTGTACCATTTGGATAAGCGGTGCATTTGTTGCAATTTTTACTAATGAGGTTGGAGCTTTAGGTGT
AGATATAAATGCTATAAATATTGCTTATAAGTGGGCTTACTGGCTTATTAACGTTTGGGGGCAGTTAAAA
ATTGCCGACTATAATTATTTAAAATTGAAGCTACTTGCATCTCTTCTTGGTCCTGCTATTGTTGTCATAA
TATTTTACATTAAAAATTTTGAAAGAATAAAATCATTACAATTTTTTGAGCAACCGGAAAAAGTATATGG
AGATGCTAGCTGGGCTAATCCGTCAGATATAGAGGCTGCTGGGCTTAGATCCAAAAAAGGTATGTTAATA
GGTGTTGATGCCGGTGGATATTTTGTTGCAGACGGATTCCAGCATGCTTTATTATTTGCTCCTACAGGTT
CAGGTAAAGGTGTGGGTTTTGTGATACCTAATCTGTTATTTTGGAGTGATTCGGTAGTAGTACATGACAT
AAAACTCGAAAATCACGGTTTGACGAGCGGTTGGCGTGAGAAACAAGGTCAGAAAGTTTTTGTATGGGAG
CCTTCTAATCCCGATGGTATTACGCATTGTTACAATCCGATTGATTGGGTTAGTACTAAGCCCGGGCAGA
TGGTTGATGACGTACAGAAAATTTCAAATCTTATAATGCCGGAAAAGGATTTTTGGAATAATGAAGCACG
AAGTTTATTCTTAGGTGTAACTTTATATTTAATAGCTGATCCTACTAAAACTAAATCTTTCGGTGAAGTA
GTGCGTACCATGAGAAGTGACGACGTAGTTTATAATCTAGCGGTCGTACTCGATACGCTTGGCGGTGTAA
TACATCCTGTTGCATATATGAATATTGCTGCGTTTTTACAAAAAGCCGATAAAGAGCGTTCGGGTGTAAT
ATCTACAATGAACTCATCGCTTGAATTATGGGCAAATCCGCTTATTGATTCTGCTACTGCATCTTCTGAT
TTCAACGTACAAGAATTTAAAAAAGTCAAAACAACCGTATATGTAGGACTCACTCCTGATAATATACAGC
GTTTACAAAAATTAATGCAGGTGTTTTATCAGCAGGCGACAGAATTTTTAAGCCGCAAAATGCCGGATTT
AAAGGAAGAGCCGCATGGGGTAATGTTCTTGCTTGATGAGTTCCCGACACTTGGAAAGATGGATACTTTT
AAAGCCGGTATAGCTTATTTTAGAGGTTATAGAGTTCGGTTATTTTTGATTATTCAAGATACGCAGCAGT
TAAAAGGAACATATGAAGATGCAGGGATGAATTCTTTCTTATCTAATGCAACATACCGTATTACTTTTGC
TGCTAATAACTATGAAACGGCAAATTTAATATCGCAGCTTGTCGGTAATAAGACGGTAGAACAAAGATCA
TTTAGTAAACCTTTATTTTTTGACCTTAATATTTCTACTAGAACCCAAAACGTTTCTCAAGTTCAAAGAG
CTTTACTTTTACCTCAAGAAGTAATACAGTTACCGAGAGATGAGCAAATTGTTTTAATAGAATCCTTTCC
GCCTATAAAATCTCGTAAAATTAAGTATTACGAAGATAAATTTTTTACTAGTAGATTATTACCGCCGACT
TTTGTACCTACTCAAGTACCTTTTGATCCTAGGGCAAATAATAATGAGGCTCAAGAAGAGACTGAAACAA
CAACTGCTCCGGAAAATAATGAGTAA
 Primer design