SecReT4
Protein ID: 68164417
T4SS name [ID]VirB [439]
Gene symbol-
Locus tagpTet_23
StrainCampylobacter jejuni subsp. jejuni 81-176 plasmid pTet (NC_007141)
Repliconplasmid pTet [GenBank: NC_007141] [Browse all T4SS(s) in this replicon]
Location [Strand]19177..19839 [+]
ProductpTet23
Component typeVirB8
UniProt IDA1WZX6, Q847A8
KEGG IDcjj:CJJ81176_pTet0036
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.3e-60, Aligned region: 9..217
Protein Sequence: 220 a.a.     [Download]
>gi|68164417|ref|YP_247551.1| pTet23 [Campylobacter jejuni subsp. jejuni 81-176]
MKNEFNTAIDYEASFRYLIEKSNKRAWLIAFISIFIAIISIIAVVLLTPLKTIEPYVIRVDNTTGMVDIL
TMLDEKEIKANEALDKYFISTYVKAREGYYYDLLNQDYLLTQLMSSEKVANEYRALYEGDNARDQILKNS
NEVSVQILSIVLGESNGVKTATVRAIITTKNLTSKGTTQATKVITLSYDYILAKASEENRFLNPLGFKVL
TYRIDDEVAQ
 
Nucleotide Sequence: 663 bp     [Download]
>gi|68164394|ref|NC_007141.1|:19177-19839 Campylobacter jejuni subsp. jejuni 81-176 plasmid pTet, complete sequence
ATGAAAAATGAGTTTAATACTGCAATAGATTATGAAGCAAGTTTTAGATACTTAATTGAAAAAAGTAATA
AAAGAGCTTGGCTTATTGCTTTTATTTCTATTTTTATAGCCATTATTTCCATTATAGCTGTTGTTTTACT
TACTCCTTTAAAAACAATAGAACCTTATGTAATAAGAGTAGACAATACTACAGGAATGGTTGATATTTTA
ACCATGCTTGATGAAAAAGAAATTAAAGCAAATGAAGCATTAGATAAATATTTTATTAGCACTTATGTAA
AAGCTAGAGAAGGCTATTATTATGATCTTTTAAATCAAGATTATTTACTTACTCAATTAATGAGTTCTGA
AAAAGTAGCAAATGAATATAGGGCTTTATATGAAGGTGATAATGCAAGAGATCAAATTCTAAAAAACTCC
AATGAAGTAAGTGTTCAAATTTTAAGTATTGTTTTAGGAGAAAGTAACGGAGTGAAAACTGCTACAGTCA
GGGCAATTATTACTACAAAAAATTTAACTTCCAAAGGAACAACTCAAGCAACAAAAGTAATAACATTAAG
TTATGACTATATCTTAGCAAAAGCTAGCGAAGAAAACAGATTTTTAAATCCTTTAGGTTTTAAAGTATTA
ACTTATAGAATTGATGACGAGGTGGCACAATGA
 Primer design