SecReT4
Protein ID: 68164420
T4SS name [ID]VirB [439]
Gene symbol-
Locus tagpTet_26
StrainCampylobacter jejuni subsp. jejuni 81-176 plasmid pTet (NC_007141)
Repliconplasmid pTet [GenBank: NC_007141] [Browse all T4SS(s) in this replicon]
Location [Strand]21906..22898 [+]
ProductpTet26
Component typeVirB11
UniProt IDQ4VR02, A1WZX9
KEGG IDcjj:CJJ81176_pTet0039
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.4e-61, Aligned region: 13..312
FtsK_SpoIIIE [PF01580], Evalue: 2.2e-05, Aligned region: 157..181
Protein Sequence: 330 a.a.     [Download]
>gi|68164420|ref|YP_247554.1| pTet26 [Campylobacter jejuni subsp. jejuni 81-176]
MSITLDKYTQKFFGEFLKDDNINEICYNGDNKIWVQNSKGLWECIDTKLDFEQAGHFATASASFKKDKID
VSRPILSCILVGGERMQIVIPPATKSEHISITIRKPSKTRFKMEDHIKSGLFEDLNPDDKNKIKPSDEEL
IKLYEARDYQNFISKAVSYGKNIIIAGETGSGKTTFMKTLIDFISLDDRIITIEDVEEIKFYEHKNFVQL
FYPSEAKSTDFLNSATLLKSCLRMKPDRILLAELRGAETYDFINVLASGHGGSITSCHAGSPEETFTRLA
LMTLQNPQGQCVPFEIIQKTLKDLIDIVVHIHAHHGKRRISGIYFKEMER
 
Nucleotide Sequence: 993 bp     [Download]
>gi|68164394|ref|NC_007141.1|:21906-22898 Campylobacter jejuni subsp. jejuni 81-176 plasmid pTet, complete sequence
ATGTCAATAACGCTAGATAAATATACTCAAAAATTTTTTGGAGAATTTTTAAAAGATGATAATATCAATG
AAATCTGCTATAACGGCGATAATAAAATTTGGGTACAAAACTCTAAAGGATTATGGGAATGTATAGATAC
TAAACTTGATTTTGAACAAGCTGGACATTTTGCAACTGCTTCAGCCTCATTCAAAAAAGATAAAATAGAT
GTATCACGCCCTATTCTTAGTTGTATTCTAGTAGGTGGAGAGCGTATGCAAATTGTTATTCCTCCTGCTA
CAAAAAGCGAACACATTTCAATTACTATTAGAAAGCCAAGCAAAACTCGCTTTAAAATGGAAGATCATAT
TAAAAGCGGACTTTTTGAAGATTTAAATCCTGATGATAAGAATAAAATCAAACCAAGCGATGAAGAATTA
ATCAAGCTATATGAAGCAAGAGATTATCAAAATTTTATATCCAAAGCTGTTAGCTATGGTAAAAATATTA
TTATCGCTGGTGAAACAGGAAGCGGTAAAACTACCTTTATGAAAACTCTTATTGATTTTATAAGCCTTGA
TGATAGGATTATCACAATAGAAGATGTTGAAGAAATCAAATTCTATGAACACAAAAATTTCGTGCAATTA
TTCTATCCTAGCGAAGCAAAAAGTACAGATTTTTTAAATTCTGCAACACTTTTAAAATCTTGTTTAAGAA
TGAAGCCTGATAGGATTTTACTAGCAGAGCTTAGAGGTGCTGAAACTTATGATTTTATTAATGTTTTAGC
TAGTGGTCATGGTGGAAGTATCACAAGTTGCCATGCAGGAAGCCCCGAAGAAACATTTACACGACTTGCT
TTAATGACTCTACAAAATCCACAAGGTCAATGCGTGCCTTTTGAAATTATCCAAAAAACACTTAAAGACT
TAATAGATATTGTCGTGCATATCCATGCCCATCATGGAAAAAGGCGTATTAGCGGCATTTATTTTAAAGA
AATGGAGAGATAA
 Primer design