SecReT4
Protein ID: 68248654
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0119
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]107635..108399 [+]
Producthypothetical protein
Component typeTfc1
UniProt IDQ4QPE1
KEGG IDhit:NTHI0119
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.4e-51, Aligned region: 19..249
Protein Sequence: 254 a.a.     [Download]
>gi|68248654|ref|YP_247766.1| hypothetical protein NTHI0119 [Haemophilus influenzae 86-028NP]
MINKTLFNSITMPYLTSSQTECLKWLALITMIIDHIGVAFSNAYPALSWCRVIGRFSYVAFGFIIALNLS
RDKVNFKSYFTWMIATAFLSEISFTLFEPNYDRLNVLFQFLSVIGVIWVYKNRQDLNSWVMFFGLGFFII
LSALSDYGLPGLLYCIGCYLFLQTKDTQFRLITMLTCVLLALFVNHSFIDNFGETIVETISVVTVVVGTM
IFILHPKGLRQCNISISRMPKLFFYLFYPVHLTIIIGIKYIFLS
 
Nucleotide Sequence: 765 bp     [Download]
>gi|162960935|ref|NC_007146.2|:107635-108399 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGATAAATAAAACTCTTTTTAACAGTATAACGATGCCTTATTTAACTTCTTCACAAACTGAATGCCTAA
AATGGTTAGCTCTTATCACGATGATTATCGATCACATTGGTGTGGCTTTTTCAAATGCTTACCCAGCCCT
ATCCTGGTGTCGGGTGATAGGTCGATTTTCCTACGTGGCGTTTGGATTTATCATCGCGCTTAATTTATCT
CGAGATAAAGTAAACTTTAAAAGTTATTTCACTTGGATGATAGCAACCGCATTTTTATCTGAAATCAGTT
TTACGCTTTTCGAGCCTAATTATGACCGTTTAAATGTCCTATTTCAGTTTTTGTCTGTAATCGGGGTAAT
ATGGGTATATAAAAACCGTCAAGACTTAAATAGCTGGGTCATGTTTTTTGGATTGGGCTTTTTTATTATT
CTTTCCGCACTCTCTGATTATGGTTTACCTGGGCTTTTATATTGCATTGGTTGTTACCTATTCTTGCAAA
CAAAAGATACTCAATTTCGTCTTATTACGATGCTAACCTGTGTATTGCTCGCACTTTTCGTCAATCACAG
TTTTATTGATAATTTCGGGGAAACTATTGTTGAAACAATCAGTGTTGTTACTGTTGTGGTCGGTACAATG
ATATTTATTCTTCACCCTAAAGGCCTTCGTCAATGTAATATCTCAATCTCTCGAATGCCTAAGCTTTTCT
TTTATCTTTTTTACCCGGTGCACTTAACAATTATTATTGGCATTAAATATATTTTTCTCAGCTAA
 Primer design