SecReT4
Protein ID: 68248655
T4SS name [ID]Tfc [47]
Gene symbolpilL
Locus tagNTHI0120
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]108498..109127 [+]
Productlipoprotein
Component typeTfc2
UniProt IDQ4QPE0
KEGG IDhit:NTHI0120
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 209 a.a.     [Download]
>gi|68248655|ref|YP_247767.1| lipoprotein [Haemophilus influenzae 86-028NP]
MKKFLLTTFALVVLSGCAHKQQTADEQQALENPNIQQGQHQVLQPEDRIVRPDIYTDYQPERTEVLREGR
YTLINFSPEEGQKYLLDQSVTVNMLGKKKRALTATVEQGLRTTLKDTGLSLCHGFGQNEPTLSTLYSRPL
PKVHYQFGPMALRDALQMLAGPAYEITINDVSRTVCFKLRPAVPERATGEKPKVETTTTTTTTTEIIEE
 
Nucleotide Sequence: 630 bp     [Download]
>gi|162960935|ref|NC_007146.2|:108498-109127 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGAAAAAATTTCTATTAACCACTTTTGCATTGGTTGTGCTTTCAGGTTGTGCACATAAACAACAAACAG
CCGATGAGCAACAAGCACTAGAAAATCCAAATATTCAACAAGGTCAGCATCAAGTTTTACAACCGGAAGA
TCGAATTGTTCGTCCGGATATTTACACAGACTATCAGCCTGAACGTACAGAAGTGTTACGTGAAGGTCGA
TACACTTTAATTAATTTCTCTCCAGAAGAAGGTCAAAAATACCTTCTAGACCAAAGTGTCACTGTCAACA
TGTTAGGTAAAAAGAAACGAGCCTTAACGGCAACCGTTGAGCAGGGATTACGCACGACGTTAAAAGATAC
AGGCCTTTCACTTTGTCATGGTTTTGGTCAGAATGAACCAACACTTTCTACGCTTTATTCCCGTCCATTA
CCAAAAGTACATTATCAATTTGGCCCGATGGCTTTACGTGATGCCCTTCAAATGTTAGCAGGGCCGGCTT
ATGAAATTACTATCAATGACGTTTCTCGTACCGTTTGTTTTAAATTACGCCCAGCTGTACCGGAACGTGC
TACAGGGGAAAAGCCGAAAGTAGAAACCACAACAACGACAACAACTACAACAGAAATCATCGAGGAATAA
 Primer design