SecReT4
Protein ID: 68248656
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0121
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]109131..109871 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDQ4QPD9
KEGG IDhit:NTHI0121
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 246 a.a.     [Download]
>gi|68248656|ref|YP_247768.1| hypothetical protein NTHI0121 [Haemophilus influenzae 86-028NP]
MNHVKKISYVAMILGMFSTAVFAEVTAANTLATQSLNQQNLVTNKLNQQELLAKSQEWGLTEQEWQRYQE
LNQGARGIWSPGLDPLTSLGVESRNEQERERYARLLAKKMHDRMERELQFQRTYDRVFAEMYPNEQPFKV
EPHISERFGRVIYFTRLENCDKCEANADRVLQYVNDKTPIDIYFVGVNNNEQIYNWAKKHNIDPNKVNRK
LITLNHDNGAWLQYADGKMPAAFQIQQDGQWQQIVY
 
Nucleotide Sequence: 741 bp     [Download]
>gi|162960935|ref|NC_007146.2|:109131-109871 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGAATCATGTCAAAAAAATATCCTATGTGGCGATGATATTAGGGATGTTTTCTACTGCTGTATTTGCTG
AAGTCACTGCGGCTAATACACTTGCTACTCAATCCCTCAATCAACAAAACTTGGTGACAAATAAATTAAA
TCAACAAGAGTTATTAGCTAAGTCTCAAGAGTGGGGTTTAACTGAGCAAGAATGGCAACGCTACCAAGAG
CTTAATCAAGGTGCTCGTGGTATATGGTCGCCAGGTCTTGACCCTTTAACCTCGCTTGGTGTGGAGTCTC
GAAATGAGCAGGAAAGAGAGCGTTATGCTCGACTACTGGCAAAAAAAATGCACGACCGCATGGAGAGAGA
GCTGCAGTTCCAACGCACTTATGATCGCGTATTTGCTGAAATGTATCCAAATGAGCAACCATTTAAGGTT
GAACCTCATATTTCAGAGCGGTTTGGACGGGTGATTTATTTTACTCGCCTAGAAAATTGTGACAAATGTG
AAGCGAATGCTGATCGTGTACTGCAATATGTGAATGATAAAACGCCTATAGATATTTATTTTGTTGGCGT
GAATAATAATGAGCAAATCTATAATTGGGCGAAAAAACATAACATCGACCCAAATAAAGTGAATAGAAAA
TTAATTACCCTTAATCATGATAATGGAGCCTGGTTACAGTATGCAGATGGCAAAATGCCTGCTGCATTCC
AAATTCAACAGGATGGGCAATGGCAACAAATCGTCTATTAA
 Primer design