SecReT4
Protein ID: 68248657
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0122
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]109850..110608 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDQ4QPD8
KEGG IDhit:NTHI0122
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 252 a.a.     [Download]
>gi|68248657|ref|YP_247769.1| hypothetical protein NTHI0122 [Haemophilus influenzae 86-028NP]
MATNRLLKIVFSLIGLGVATHSVAFNGFGTDIDGYIKDASNRYQVDEAMLRGLVKIEDGWYGNVSPTGAT
GVGQFTRGTWNWLATTDEGRALGMTQITRYNRDTPFDPRKNNQLNTLATALLARWHINQFFERGIKPSHE
NLYLAHNIGIDGLHRALQGRATREDILNMKRNGMKKGMSVQGFLVYQSERFNVSKQIANFQRPSVSPRYQ
IENKPLPANLHWVSPTETAMRWVEPASNQTNQQAIRWQNPTN
 
Nucleotide Sequence: 759 bp     [Download]
>gi|162960935|ref|NC_007146.2|:109850-110608 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGGCAACAAATCGTCTATTAAAAATCGTATTTAGCTTAATCGGTCTTGGCGTTGCGACTCACTCCGTTG
CATTTAATGGCTTTGGAACTGATATTGATGGCTATATTAAAGATGCATCTAATCGCTACCAGGTCGATGA
AGCGATGCTACGTGGGTTAGTAAAAATTGAAGATGGGTGGTATGGAAATGTTTCCCCAACCGGGGCAACC
GGTGTGGGGCAATTTACCCGGGGCACCTGGAATTGGCTTGCAACAACTGATGAGGGGCGAGCCTTAGGTA
TGACTCAAATCACTCGTTACAATCGTGATACACCTTTCGACCCTAGAAAAAACAATCAACTTAACACTCT
AGCAACCGCACTTTTAGCTAGATGGCATATTAATCAGTTTTTTGAGCGAGGCATAAAACCATCCCATGAA
AATTTATATCTTGCTCATAATATCGGTATAGATGGTTTACATCGAGCGCTACAAGGTAGAGCAACACGTG
AAGATATTCTAAATATGAAGCGTAACGGGATGAAAAAAGGAATGTCGGTACAAGGCTTTCTTGTTTATCA
AAGTGAGCGTTTTAATGTCAGTAAACAAATAGCTAACTTCCAGCGCCCTTCAGTATCACCACGTTATCAA
ATTGAGAATAAACCATTACCAGCCAATTTACATTGGGTTTCTCCAACAGAAACCGCTATGCGTTGGGTTG
AGCCAGCGTCAAATCAAACAAATCAACAAGCTATTCGTTGGCAAAATCCAACCAATTAA
 Primer design